KEGG   Amylolactobacillus amylophilus: LA20533_06175
Entry
LA20533_06175     CDS       T05031                                 

Definition
(GenBank) ATP-dependent DNA helicase PcrA
  KO
K03657  DNA helicase II / ATP-dependent DNA helicase PcrA [EC:3.6.4.12]
Organism
lah  Amylolactobacillus amylophilus
Pathway
lah03420  Nucleotide excision repair
lah03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lah00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    LA20533_06175
   03430 Mismatch repair
    LA20533_06175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lah03400]
    LA20533_06175
Enzymes [BR:lah01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     LA20533_06175
DNA repair and recombination proteins [BR:lah03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     LA20533_06175
   MMR (mismatch excision repair)
    Other MMR factors
     LA20533_06175
SSDB
Motif
Pfam: UvrD_C UvrD-helicase AAA_19 UvrD_C_2 Viral_helicase1 AAA_30 Terminase_6N ResIII AAA_16 AAA_22
Other DBs
NCBI-ProteinID: APT18861
UniProt: A0A0R1YPV9
LinkDB
Position
1178461..1180704
AA seq 747 aa
MSADALIKNLNEQQSLAVRTTEGPLLVMAGAGSGKTSVLTRRIAYLVEEKSVLPWNILAI
TFTNKAAKEMRDRIEQQLGAQANDIWISTFHALCVRILRREAEKINYTSSFSIADPAEQL
TLVKQILKRLNYDPKIYDPKNILHQISNAKNDLVDPDGYQKLVATPFERVVGEVYHEYQA
ALQRDQSMDFDDLIMQTIILFKLDPPTLHFYQNKFRYISVDEYQDTNEAQYQLVKMLAAQ
YRNLCVVGDADQSIYGWRGANMENILNFEQDYPDAQTIMLEQNYRSTSHILNAANSVIKN
NVNRKPKDLWTDQGEGAKITYYRAQSESDEAHFVDSKIVEAIEAGKREYKDFAVLYRTNA
QSRSVEEGLLKANIPYKIVGGHKFYDRKEIKDVLAYLKLIANPADSMSLNRIINVPKRGI
GPGTMEKLITFSDANEWSLFEGMRNLVLSPIKGRVAQTMMDLATILTDAKEYSTSHSVTS
TTNKILEDTGYVAALKAAHTLEADTRIENIDEFLSVTKKFDDQYEPTSEESNQLSDFLAD
VSLLSDQDDLENQNNQVALMTLHAAKGLEFPVVFLVGLEEGLFPLSRASMDESELEEERR
LAYVGITRAREQLYLTNAVSRLLYGRTQVNMPSRFIGEIADEDLEQENPTAANVFVGSGN
TTNVPFARRNDRATATVYQPKVAVHSAGAIGAEKSTWNVGDKVTHKAWGEGTVVKVSGSG
DDQELDIAFENEGIKRLLAAFAPIKKV
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgagtgcagatgcattaatcaaaaatctgaatgaacaacaaagtctggccgtcaggaca
acggagggaccactccttgtgatggctggcgctggtagtggtaagaccagtgttttgact
agaagaattgcctacctggttgaagaaaagagtgtgttgccgtggaatatcttggcaatc
acctttacgaataaggctgcaaaggaaatgcgcgacagaattgagcagcagcttggggcg
caggcaaacgacatctggatttcaaccttccatgctctttgtgtgcggattctccgtcgt
gaggcagagaaaattaattatacgagttcattctcgattgctgatcccgcggagcagtta
acgttggtcaagcaaattctgaagcgcttgaattatgatcctaagatttatgacccgaaa
aatattctgcaccaaattagtaacgcgaagaacgatttggttgacccagacggctatcag
aaactcgtcgctaccccttttgaacgcgttgttggtgaggtctatcacgaatatcaggca
gcgctccaacgcgaccagtcaatggactttgatgatttaataatgcagaccattatcttg
ttcaagttagatccaccaacgctccacttctaccagaataagttccgctacatcagtgtg
gatgagtaccaagatactaatgaggctcagtatcagcttgtgaagatgttggctgcccaa
tatcgcaatctttgtgtcgtgggtgatgctgaccaaagtatctatggttggcgtggtgcg
aacatggagaatatcctgaacttcgagcaggattatccagatgcccagacgattatgttg
gagcagaattaccggagcacatcgcatattttaaatgccgctaactcggtcatcaaaaat
aatgtcaacagaaagccaaaggatctgtggacggaccagggtgagggagcaaagatcact
tattatcgggctcaaagcgagagcgatgaggcacacttcgttgacagtaagattgttgag
gccatcgaggcgggcaagcgagaatacaaggattttgccgtgctctaccggactaatgct
caatcgcgttcggtcgaagagggtctgttaaaggcgaatatcccttataaaattgtgggt
ggccacaagttctatgatcgaaaagaaatcaaggacgtactggcgtacctgaaattgatt
gcgaacccggccgactcgatgagtttaaataggattatcaacgtccctaaacggggtatt
ggtccaggcacgatggagaagctaataacgtttagcgacgcaaatgaatggtcgttgttt
gaagggatgcgaaatctcgtattatcgccgatcaagggccgtgtggcgcagacgatgatg
gatttggccacaattctcaccgatgccaaagaatacagcactagccactcggtgactagc
accacgaacaagattcttgaggacaccggttacgtagcggcactgaaagcggcccataca
ttagaggcggacacacgaatcgagaatatcgatgaattcttgtcggtcaccaagaaattc
gatgaccagtatgaaccaacttctgaggagagtaatcaactaagtgatttcttggctgat
gtatcgttattatcggaccaggatgacttggagaatcagaataatcaagttgctttgatg
acgctccatgctgcaaaagggctggaatttccagtggtctttcttgttggactcgaggag
gggctctttcctctgagtcgtgcaagtatggatgagagtgagcttgaggaggagcgccgc
ttggcctatgttggtattactagagcgcgtgaacaactttacctcaccaacgcagtttct
agattgctttatgggcggacacaggtgaatatgccatctcgtttcattggtgagattgcc
gatgaggatctggaacaagagaacccaaccgccgcaaatgtttttgtcgggagtgggaat
acgacgaatgttccatttgctagaagaaacgaccgggcaaccgccacggtttaccagccg
aaagttgctgtgcatagtgcaggtgctattggggctgagaaatcaacctggaatgtgggc
gataaggtgacacataaggcgtggggcgagggaacagtcgtcaaagtcagcggtagcggt
gatgatcaggaattggatattgccttcgaaaatgagggaattaaacgattgctggccgca
tttgcaccaatcaagaaagtctaa

DBGET integrated database retrieval system