KEGG   Lactobacillus amylophilus: LA20533_07050Help
Entry
LA20533_07050     CDS       T05031                                 

Definition
(GenBank) DNA-binding response regulator
Organism
lah  Lactobacillus amylophilus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C SPT16 Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: APT19015
UniProt: A0A1L6XDH0
LinkDB All DBs
Position
1341911..1342624
Genome map
AA seq 237 aa AA seqDB search
MRILMVEDDNSVATMMEMFFQKEQWQLDVAADGQQAIDMFKTKQDEYDMITLDLNLPGKD
GMQVAREIRAVSKAIPIIMLTARDSESDQVLGLELGADDYVTKPFSPMTLIARIKALHRR
AELTETETQEQETSGEYDVQTNHLKISQRLREVLFDDQVVEGLTPKEFDLLLTMSQKPKQ
VFSRDKLLELVWGYQYFGEERTVDAHIKKLRQKLEKVGPQVIQTVWGIGYKFDDTEV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgagaatattaatggttgaagacgacaattcggtggccacaatgatggagatgttcttt
cagaaggagcagtggcagttagatgtagcagcagatggccaacaggcaatcgacatgttc
aagacgaagcaggacgaatacgacatgattacgctcgacctcaatttgcccgggaaggat
gggatgcaggtggcgcgggagattagagccgtctctaaggccattcccatcatcatgctt
acggccagagactcggagtcggatcaggtacttggcctagagcttggtgcagacgactac
gtcacaaagcccttcagtccgatgaccttgattgcccgcatcaaggctttgcaccggcgc
gcagaattgaccgaaaccgagacacaagaacaagaaacgagtggtgaatacgatgtgcag
acaaaccacctgaagattagccaaagactccgggaagtcttgttcgacgaccaggtcgtt
gaaggactgacgccaaaggagttcgatctgctgctaacgatgtcccaaaagccaaagcaa
gtcttctcgcgcgataagctcttagagctagtctggggttaccaatactttggcgaggag
cgcacggttgacgcccatattaagaagctccggcagaagctcgagaaggttgggccccag
gtcattcagacggtgtggggaatcggttataaatttgacgatacggaagtttag

DBGET integrated database retrieval system