KEGG   Lactobacillus acidophilus 30SC: LAC30SC_04745Help
Entry
LAC30SC_04745     CDS       T01436                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
lai  Lactobacillus acidophilus 30SC
Brite
KEGG Orthology (KO) [BR:lai00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LAC30SC_04745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C Spore_permease Phage_holin_3_6
Motif
Other DBs
NCBI-ProteinID: ADZ07100
UniProt: F0TEN4
LinkDB All DBs
Position
complement(961604..962989)
Genome map
AA seq 461 aa AA seqDB search
MKFHIFRKQSIQNYLGKDIKFSKTMNALDLMSLGVGAVIGTGIFILPGTVAATAAGPGVS
LSFMVAAIVCAFAGMCYAEFASAIPVAGSAYSYGNIVYGEFTGWIIGWALILEYMLSVAT
VAAGWSSYFSSFISPFGLKIPKAVSGPMNLSHGVYFDLVSVLIILIISILLSRGMKNSIK
INVVAVFIKIAIILIFIFVGMQFIKSSNYHPFLPYHASGVIKGATTVFFAFLGFDVVSSS
AAEVKNPKKNMPLGIIGTLAIAAVLYFGVSIVLTGMVKYTKLNVANPVAFALQYVHQDWV
AELLSFGAMLGMATMMLTMIYSSSRLIYAMARDGLLPATFSKLDKKHHSPQNALVAVTII
IALGAAFFSVDQLANLVNFGTLFAFTLVSFGILKLRKRTDIVNDGFKVPGYPYLPIISGL
ICIFMICHLSSEVYLMAAIWLILGTVIYFVYGYRHSQLEHE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcacatatttagaaaacaaagcattcaaaactacttaggaaaagatatcaag
ttttccaaaacaatgaatgccctcgacctaatgtcacttggggttggtgcagttatcggg
actgggatctttattctgcctggtacggtagctgctacagctgctgggcctggagttagt
ttgtcattcatggtcgcagcaatcgtgtgcgcctttgccggaatgtgttatgccgagttt
gcttccgcaattccagttgctggtagtgcttattcatacggtaacatcgtttacggcgag
ttcaccggttggatcattggttgggccttaatcttggaatacatgctatctgtggctacc
gttgccgcaggttggtcatcatactttagttcatttattagtccgtttggcttaaaaatt
cctaaggccgtttcagggccaatgaatttgtcacatggcgtttactttgaccttgtttct
gttttaataattttgattattagtatcctgctgtcacgtggaatgaaaaattccatcaag
attaacgttgttgcggttttcattaagattgcgattattttgatcttcatctttgtgggg
atgcaatttattaagtcaagcaattatcacccattcttgccataccacgcttctggtgtg
attaaaggtgcaactaccgttttctttgctttcttaggctttgacgttgtttcttcatca
gctgccgaagttaagaatcctaagaagaatatgccactaggcattattggtactctagca
attgcggctgtcctttactttggcgtttccattgtcttgacaggaatggttaaatacacc
aagttaaacgtagctaatccggttgcttttgccttacaatatgtccaccaagactgggta
gccgaattattatcatttggtgccatgctaggaatggcaaccatgatgctcacgatgatc
tattcaagttcgcgtttaatttacgccatggctagagatggtcttttaccagcaactttc
agtaagcttgataaaaagcaccattctcctcaaaatgccttagttgcagtaacaattatt
attgccttaggtgcggcattcttctcagtagatcaattagccaacttggttaactttggc
acattatttgccttcaccttagtatcatttggtattttaaaattaagaaagaggacagat
atcgttaacgacggtttcaaggttcctggttatccatacctgccaatcatttctggctta
atctgtatctttatgatttgtcacttaagctcagaagtttacttaatggctgcaatttgg
ttaatccttgggacagttatctacttcgtttatggttatcgtcacagtcaactagaacat
gaataa

DBGET integrated database retrieval system