KEGG   Leptospira alstonii: A0128_04240Help
Entry
A0128_04240       CDS       T04558                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
laj  Leptospira alstonii
Pathway
laj00010  Glycolysis / Gluconeogenesis
laj00071  Fatty acid degradation
laj00350  Tyrosine metabolism
laj00625  Chloroalkane and chloroalkene degradation
laj00626  Naphthalene degradation
laj01100  Metabolic pathways
laj01110  Biosynthesis of secondary metabolites
laj01120  Microbial metabolism in diverse environments
laj01130  Biosynthesis of antibiotics
laj01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:laj00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A0128_04240
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A0128_04240
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    A0128_04240
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    A0128_04240
   00626 Naphthalene degradation
    A0128_04240
Enzymes [BR:laj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     A0128_04240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C PUA 2-Hacid_dh_C AlaDh_PNT_C Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AOP35898
UniProt: A0A1D7V224
LinkDB All DBs
Position
1:886633..887667
Genome map
AA seq 344 aa AA seqDB search
MKAAILESGKRSLEIRDIAVPNVGPGQVKVKIKACGICGSDVHLVVHGTLKCKHFPRVPG
HESSGVIEEVGENVSRFKKGDRVVIAAGTSCGVCSYCKAGHENLCKELGVFGFDRDGSFA
EYNVVEERYLYALPDAIPFDQGAILADAVSTPYHAIRYRGNIVDGDTVAIFGCGGLGIHA
VAVARALTTGKVIALDVDKGPLENAVKYGADEVINLKEVRNPGKALKEVSKGVDLLADFS
GYMSNIEESLRAMNPGGRIVLVGIGRQPLKFQIPFILIEKMISVSGSYGSDRRAIPELID
LYLKGKINLTHSITSHHSLEDLNECLEALDERKGNPIRFIIQPS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgcaatcttagaatccggaaaaagaagtttagaaatccgcgacatagccgtg
ccgaatgtgggcccgggtcaagtaaaagtaaaaatcaaggcctgcggaatctgcggttcg
gacgtacatcttgtagttcatggaacgctcaagtgtaaacattttccaagagtccccggt
cacgaatcttccggagtgatcgaagaagtaggggagaatgtaagtcgttttaaaaaagga
gaccgagttgtgatcgctgcgggaacttcttgcggagtttgttcttattgtaaagcgggt
cacgaaaatctttgtaaagaactcggagttttcggttttgatcgggatggaagttttgcg
gaatacaacgtcgtggaagaacgttatctctacgcacttccggacgcgattccttttgat
caaggggcgattcttgccgacgcggtttccactccgtatcacgcgattcgatatcggggg
aatatcgtggacggagacacggttgcgatcttcggttgcggcggtttgggaattcacgcc
gttgcggttgcaagagcgcttactaccggaaaggtgatcgcgctcgatgtggataaaggg
ccgcttgagaacgcggtaaaatatggagccgacgaagtcatcaatctcaaagaggtcaga
aatcccggaaaggctttgaaagaagtaagcaaaggggtcgatcttctcgctgacttttcg
ggttatatgtccaacatcgaagagtccctaagggctatgaatccaggcggaagaatcgtt
cttgtcggaatcggaagacaacccttgaaatttcagattccttttatactcatcgaaaag
atgatctcggtttcgggatcctatggttcggatagaagggcgattccggagctgatcgat
ctctatctaaaaggaaagatcaaccttacccattccatcacttcccatcattcattagaa
gatttgaatgaatgtttggaagccttggacgaaagaaaaggaaatccgattcggtttatc
attcaaccgagttga

DBGET integrated database retrieval system