KEGG   Leptospira alstonii: A0128_12035Help
Entry
A0128_12035       CDS       T04558                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
laj  Leptospira alstonii
Pathway
laj00473  D-Alanine metabolism
laj00550  Peptidoglycan biosynthesis
laj01100  Metabolic pathways
laj01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:laj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A0128_12035
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A0128_12035
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A0128_12035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laj01011]
    A0128_12035
Enzymes [BR:laj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A0128_12035
Peptidoglycan biosynthesis and degradation proteins [BR:laj01011]
 Precursor biosynthesis
  Amino acid ligase
   A0128_12035
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AOP36054
UniProt: A0A1D7V2M0
LinkDB All DBs
Position
1:complement(2552228..2553295)
Genome map
AA seq 355 aa AA seqDB search
MSEAISTVIVYADLHEFTGEFPDSYKQEWESSASIERILELLNELGEVAELVTTPKDLLE
KLNQYSSLGFKDRPVIFHLMEGFRSRNREALVPATAEFFGFPHTGSDAFAQNVSLDKNLT
KIFAKSLGIPVAPGFSIEYETRKNFVLSKEVVFPCFLKPSGEGSSLGIGEKSIVQNEKEL
RSLTRDLPEEYFPYLVEGYLSGSEYTISVMGSSKSGYRASRAGRLILREDLKVEEVYGEK
TKSKSAMPETLVFDCPVERELFLQEQSLSFCKALGTSGPARLDWKCDDAGEPFFLEINLT
PGLSPFYSTFPICYRQGLGEEKSLFSEILMIARSEWESPRFLYSKLKTNSILSKK
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaggcgatttccaccgtaatcgtctacgcagatctccacgagtttacgggagag
tttccggattcttacaaacaagaatgggaatcttccgcttccattgagaggattctcgaa
ttgttaaacgaactcggggaagttgccgaactcgtgacgacgccgaaagatctattagaa
aaattgaatcaatattcttccttaggttttaaggatcgaccggtgatttttcatctgatg
gaagggtttcgttctcggaacagagaagccttggtccctgcgacggccgaattttttgga
tttccgcacaccggatcggacgcattcgctcaaaacgtttctttggataagaatttgacg
aagatctttgccaagtctctaggaattccagtggccccaggattctccattgaatatgag
actcgaaagaattttgttctttcaaaagaggtcgtgtttccctgttttttgaaaccttcc
ggagagggttcgagtctcgggatcggagaaaaaagtatcgttcaaaacgaaaaagaactt
cgttcgctgacgcgtgaccttccggaggaatactttccctatttggttgagggatacttg
agtggttctgaatatacaatttccgtaatgggttcatcgaaatcgggttatcgcgcgagt
cgcgcggggcgtttgattctgagagaggatttgaaagtagaggaagtctatggagaaaaa
acaaagtctaagagcgctatgccggaaactttggtctttgattgtccggtagaaagggaa
ttgttccttcaggaacagagtctttctttttgtaaggccttgggaacttccggacctgcg
cgcttggattggaaatgcgacgatgcgggtgaacctttctttttggaaatcaacctgact
ccgggattgtctccgttttattctacctttccgatttgttatcgtcagggcttaggggag
gaaaaatccttgttttcagagattctaatgatcgcacgttcggaatgggaatctcctcga
tttttatattctaagttaaagacgaattccattctttcaaaaaaatag

DBGET integrated database retrieval system