KEGG   Lingula anatina: 106151318Help
Entry
106151318         CDS       T04921                                 

Definition
(RefSeq) thymidine kinase, cytosolic
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lak  Lingula anatina
Pathway
lak00240  Pyrimidine metabolism
lak00983  Drug metabolism - other enzymes
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    106151318
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    106151318
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     106151318
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TK AAA_14
Motif
Other DBs
NCBI-GeneID: 106151318
NCBI-ProteinID: XP_013379988
UniProt: A0A1S3H1U0
LinkDB All DBs
Position
Unknown
AA seq 232 aa AA seqDB search
MTSCVNMTNLSPDLCNKGQLQIIFGPMFSGKSTELIRRMKRYQIANYHCLLIKYANDVRY
DKGGVATHDRQILPAVAATKLKDLDDMAKQAEVIGIDEGQFFPDVVDFCEDMANKGKVVI
VAALDGTFQRKGFGDILNLVPLAENIIKLNAVCMICYGDASYTKRKGNETEVEVIGGADK
YLAVCRACFQSPVKESPKRSNKTPFCTPQQTNPLARQLFQSKENTLPMDFTS
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgacatcctgtgtgaatatgacaaatttatctccagatttatgcaacaaaggacaatta
cagattatttttggtccaatgttctctggaaaaagcacagaacttatccgaagaatgaaa
agataccagatagccaactaccattgcctccttattaaatatgctaatgatgtcagatat
gacaaaggaggcgtggccactcatgacaggcaaatattaccagcagttgctgccaccaaa
ctgaaggatcttgatgatatggcaaagcaggcagaggtgattggtattgacgagggacag
ttttttcctgatgtggtagatttctgtgaagacatggcaaacaagggaaaggttgtcatt
gtggcagcactagatggtacttttcaaagaaagggatttggggatattttgaacttggtt
ccactggcagaaaacatcatcaagcttaatgctgtatgcatgatatgctatggggatgca
tcttataccaagaggaaaggaaatgaaactgaggtagaggtaattggtggagcagacaaa
tacttagccgtctgccgtgcttgttttcagtcacctgtcaaagagtctccaaagcgttca
aataaaacaccattttgcacaccacagcagaccaaccccttggcacgccaacttttccag
tccaaggaaaatacattaccaatggattttactagctga

DBGET integrated database retrieval system