KEGG   Lingula anatina: 106152096Help
Entry
106152096         CDS       T04921                                 

Definition
(RefSeq) translocation protein SEC63 homolog
  KO
K09540  translocation protein SEC63
Organism
lak  Lingula anatina
Pathway
lak03060  Protein export
lak04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    106152096
   04141 Protein processing in endoplasmic reticulum
    106152096
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:lak03110]
    106152096
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:lak02044]
    106152096
Chaperones and folding catalysts [BR:lak03110]
 Heat shock proteins
  HSP40 / DNAJ
   106152096
Secretion system [BR:lak02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   106152096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 DnaJ DUF1804
Motif
Other DBs
NCBI-GeneID: 106152096
NCBI-ProteinID: XP_013381039
UniProt: A0A1S3H7E2
LinkDB All DBs
Position
Unknown
AA seq 782 aa AA seqDB search
MAGMKFEYDEKGGTFYYFLLSFCALIVIPATYYLWPRKTKKDDEKSKRQCYCEPCLLKRT
HVNSKDSYSNLKKRATQVVLIIGWVILIFLAYKVSTLELDHVEYDPFVELEIDREASQGE
IKKAYRKLSLKYHPDKEGGDPHKFMRIAKAYAALTDEESRNNWMLHGNPDGPGATQFGIA
LPKWIVEKENSIWVLALYGLAFIIILPIVVGTWWYKSIKFSADQILLDTTQLYLFFFHKT
PNMIIRRVIMILAGSFEFEKSHNNEIVERPSDNEELPPLMKYLPNLQEKNKEKPLCFPYS
VKARILLHAHFSRLELPRNTLELDKNYILKKCPYLVNEMVNTVAQLVALAYAGRAQHLPR
LETVENVMKVSQMLVQALWETKSPLLQLPHISEDMLKHFVTRKRNIRSIKQFASMNEEDR
RLLLRTLSDSEYRDVMNVCAQMPHIDLTIKSEVIDEEDSSITAGSIVTATVTLVRKNIEE
MFNIDGGEEEEDGEEKEEGQENDNEEEEDQEDEENKEANEVTDSPKRKTKPWEKQQKKKK
GKGGGKNKKKAPKQPYKRPVATNGNAPGQGDQNTGVSSEGVEDVPKKPKKEKNSDREDGS
ESENESDSDVSGGENEKDENEDSHKEGGEDDDEDPEWMKKFQKQAKKENSLETKSKISHS
VHCPYFPLDKQEYWWLYVADRKNHQLITAPVLVTSLRDTEELQITFKAPDKPGIYQFSVN
LRSDSYMDFDITQNIKLDVKEAKKIENHPQWDISDEEDENKDDEDEDVTDSEASSEEDSD
EE
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggctggcatgaagtttgagtacgacgagaaaggaggaactttttattatttcctcctt
tcattctgcgctttgattgtgataccagccacctattatttatggcctagaaagacaaag
aaagatgatgaaaaatccaaaaggcaatgttattgtgagccgtgtttgttaaaaaggacc
catgtaaacagcaaagattcctatagcaacttgaaaaaaagagccacccaagtggtgctg
attattggatgggtgatactgatttttctagcatacaaagtttcaactcttgaattggat
catgttgagtatgatccatttgttgagttagaaattgacagggaagctagtcaaggtgaa
attaaaaaagcataccgtaaacttagtttaaagtatcatcctgacaaggaaggaggggac
cctcacaaattcatgaggattgcaaaagcttatgcagctctaacagatgaagaatccaga
aacaattggatgttgcatggcaatcctgatggacctggagccactcagtttggtatagct
ttaccgaagtggattgtagagaaagagaattccatatgggttttggccctttatggattg
gcatttattataatcctacctatagttgtgggcacatggtggtacaaatctatcaagttc
agtgcagaccagattctgctggatacgacacaactttacttgttcttcttccacaagact
ccaaacatgatcattaggagggtaattatgatattagctggttcctttgagtttgaaaaa
agtcacaacaatgagatagtggaaagacccagtgacaatgaagagctgcctcctcttatg
aagtatctccctaacctccaagaaaagaacaaggagaagccactgtgtttcccgtacagt
gtcaaagccaggatattactgcatgcacatttttccagattggaacttccacgtaacacc
ttggaattagataaaaattatatattgaagaagtgcccatatttagttaatgaaatggtg
aacacagtagcccagctggtagccctggcttatgcagggagagctcaacacctacccagg
ctggagacagtggagaatgtgatgaaggtcagccagatgctagtccaggctctgtgggag
acgaagagtcctctcctgcagctgccacatattagtgaagatatgctaaaacattttgtc
acacgtaagagaaacattagatctataaaacagtttgcaagcatgaatgaagaagacagg
cgcttacttctgcgcactttgtcagacagtgaatacagagatgttatgaacgtctgcgcc
caaatgccacatattgacttaacaattaaatctgaagttattgatgaagaagactcctcc
atcacagcagggtctatagtaacagctactgtaactcttgtaagaaagaacatagaggaa
atgttcaatattgatgggggtgaagaggaagaggacggggaggaaaaagaagaaggtcaa
gaaaatgataatgaggaagaagaggatcaagaagatgaagaaaacaaagaagcaaatgag
gtgacagattcaccaaaaaggaagactaaaccttgggaaaagcaacagaaaaagaagaag
ggtaaaggtgggggtaaaaacaagaagaaagctcctaaacaaccatacaaaagaccagtt
gctaccaatggaaatgctccaggacaaggggatcaaaacacaggtgtatctagtgaaggt
gttgaagatgtacccaagaaacccaagaaggagaagaacagcgatagagaggatgggtca
gagagtgaaaatgaaagtgatagtgatgtcagcggaggagaaaatgaaaaagatgagaat
gaggacagtcacaaagagggaggagaggacgatgatgaggacccagaatggatgaagaag
ttccagaaacaagccaagaaggaaaactccctggaaaccaaatcaaaaatctcgcattct
gttcattgtccatatttcccattggacaaacaagagtactggtggctgtatgtggcagac
aggaagaaccaccagctgatcacagctcctgtcctggtgacaagtctaagagatacagaa
gagctccaaatcaccttcaaagctccggacaagcctggcatttatcagttctcagtgaac
ttgagatcagactcctacatggactttgacattacccagaacattaagcttgatgtaaag
gaggccaagaagattgagaatcatcctcagtgggatatttctgatgaggaagatgagaac
aaggatgatgaagatgaggatgtcaccgactctgaggcttcctctgaagaggattccgat
gaggaataa

DBGET integrated database retrieval system