KEGG   Lingula anatina: 106152447
Entry
106152447         CDS       T04921                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lak  Lingula anatina
Pathway
lak04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106152447
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lak03000]
    106152447
Transcription factors [BR:lak03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106152447
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DivIC DUF4407 LMBR1
Other DBs
NCBI-GeneID: 106152447
NCBI-ProteinID: XP_013381485
UniProt: A0A1S3H5T6
LinkDB
Position
Unknown
AA seq 701 aa
MAADVLSATDTQFFADNLLSNEDWDPAHLDKLDDFSSLIDVEASLASDELLHQLPQDLEL
PMLEDGMSPGELGEFDFGPDWMETDGLRDPGDNSSDSGISSVSIKQEPFSPALSHTSDCS
GDSFLQQTPLDQLPLLNQFDVKLESPPPTPPQDNSDSAVQYIQPSAISCGVTFQKGAAAA
AQPAHSKPHITTVKLTHVTGLNPDSKPLPTKVVNVLNSKVKIQPKLPNSSACVTPAPSPP
PPTPPGVAPGSPCAGSQGTAASKPLVLTAEEFARLTAQGVLKFHPPEQEANKTNSSVAQC
IPVPQGEDPRVWKRQQRMIKNRESASLSRKRKKEYMTTIENQLQEISRENEKLRQENQNL
KRKLSLLNSENMALKRSTGSTKVTATCLLTVLFMFALNLGPINNLVFKSSSETSLAAIPM
SSVHPGGGRHLLTYDETMQQPISGKYFPRSKASFEDIESTLAELKRGFEREKFFRKNKDF
IAFNSELESLCPVYFNKTESQRLANELTGWVLAHKEAQKKKKILEEENIREKKAVEAKNR
KPTRKKYVKPKTLHAMMKGDLDIKYAKDSYPGSSQYQVQVFNSPDKSYMDFLDSIHRRND
TFYVVSFRRDHLLLPAVAHNKTMRPRMSLLMPALPLNETMQPPPGDMAMMQIDCEVMNTR
LLHIKNTAVPSFMKEPPSNVTHTVVTNTETPDHLPREEVIP
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggcggcggatgttttatcagccactgatacccagttttttgcggataatttattgtcg
aatgaagattgggatccagctcacctggacaagttagatgacttctccagtctcatagat
gtggaggcaagtttagcctctgatgaactgcttcaccagctgccacaggatttagagctg
cctatgttagaagatggtatgagtcctggagagttgggagagtttgactttggtccagac
tggatggaaacagacgggttgagagaccctggggataacagcagtgacagtggcatcagc
agtgttagtatcaaacaagaacctttctcccctgctctgtctcatacctcagattgctct
ggtgactccttccttcagcagaccccccttgatcagctgccattactgaaccagtttgat
gtgaagcttgagagtcctcctccaactcctccccaagacaacagtgacagtgcagtccag
tatatacagccttcagccattagttgtggtgtcacattccagaagggggcagcagcagca
gctcaacccgcacacagcaagccacacattaccacagtaaaactgacacatgtaacggga
ctgaacccagacagtaagccactgccaaccaaagttgtcaatgtgttgaattctaaagtg
aagatacagcccaagttacccaatagttctgcctgtgtgacccctgcaccctccccaccg
ccaccaacgccacctggtgtagcacctggctcaccctgtgcaggtagtcaaggcacagct
gcctccaaacccctagttctcacagctgaagagtttgcccggcttactgcccagggagta
ctgaagttccatcccccagagcaggaggccaacaagaccaacagctcagtagcacagtgt
atcccagtaccacagggagaggatccaagagtttggaaacgacaacagagaatgataaag
aatagagaatctgcaagcttgtcaagaaaaaggaaaaaagagtacatgactacaatagaa
aatcaacttcaagagatttcaagagagaatgagaaactcagacaagagaaccagaatttg
aaaagaaaacttagtttattaaattcagagaacatggcattaaagcgcagcacaggttca
acaaaggtgacagccacctgcctacttacagttctcttcatgtttgccctcaatttgggg
cccataaacaatttagtatttaaaagctcatcagaaaccagcctagctgccattccaatg
agttcggtccatcctggaggtgggcgccatctattaacctatgatgaaactatgcagcag
cccattagtgggaagtatttcccaaggagcaaagcaagctttgaagacattgagagcaca
ttagccgaactgaagaggggatttgagagagaaaagtttttcagaaaaaataaagacttc
attgcatttaatagtgagctggagtccctctgtccagtgtacttcaataaaactgaatct
caaaggttggctaacgagctgacagggtgggtcttggcacacaaagaagcccaaaagaaa
aagaaaattttagaagaagaaaacatcagggaaaagaaggctgtggaggctaagaacaga
aaacctaccaggaagaagtatgtgaaaccaaagacattgcacgccatgatgaaaggagat
ttggacattaaatatgcaaaggatagttaccctggcagtagccagtatcaggttcaggtc
ttcaacagcccagacaagagctacatggatttcttggattccattcacagaagaaatgac
acattttacgtggtgtcttttagaagggatcatcttctcttgccagctgtggctcacaat
aaaaccatgcggcccaggatgtccctgttgatgcctgcactgccactgaatgagactatg
cagcccccgccaggtgacatggccatgatgcagatagactgtgaggtgatgaacacgcga
ctcttgcacatcaagaacaccgctgtgccgtcttttatgaaagaacctcccagcaacgtg
acgcacactgtcgtaacaaacacggagactccagaccatttgccgcgagaggaagtgatt
ccataa

DBGET integrated database retrieval system