KEGG   Lingula anatina: 106154548Help
Entry
106154548         CDS       T04921                                 

Definition
(RefSeq) uncharacterized protein LOC106154548 isoform X1
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lak01001]
    106154548
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     106154548
Protein kinases [BR:lak01001]
 Receptor tyrosine kinases (RTK)
  RET family
   106154548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase fn3 Kinase-like Pkinase_fungal Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 106154548
NCBI-ProteinID: XP_013384384
UniProt: A0A1S3HH76
LinkDB All DBs
Position
Unknown
AA seq 1129 aa AA seqDB search
MDALRRISVLLFLFSTGLQTTVSSHLGLGVELGRCRTRCLQFLTLEVNDEECQKNGNCKM
CWETCEFLQWEPSKWNVMCNAPHICFPGCKSSCEFWDHHSTAITQNPLYELLKPIQVKNN
NGALRLEWIPPVSEKNSERFVYILSSRDVNDTFSDWYTDIQTADMWVEYEATSFSNLSNT
KYQFQLIVVNENGTVAISETETLDLSHLHAPSHQPDNPLNISVIVERDNSSTFAYVHWQQ
MSAERTDYSVFWGMEDCNVNRSLPYCTIPPDYFATYITDSLEGDVEVKLNADLTFNSKYF
VQVECSTTGMVSPKIFFCTPGCENPDPTFTVCLPDEVIEKDHNTPSRQPDNPLNISVIVE
RDNSSTFAYVHWQQMSAERTDYSVFWGMEDCNVDKSLPFCTVLPDYFATYKTDSLAGDVE
VKLNADLTFNSKYFVQVECSTTGMVSPKIVFYTPGCENPDPTFTVCLPDEVIEEDDNITV
TATTWAPICHNLTYSHSENKWAVVISWPPPAQGVPIRYNVSWMTDFREGDSMYSAGQTST
TENHVVLMLPGGQHYEVLVMAVYSDPKESQYSDYLYFNLLAKVPQVEASKNGTTDGIKVE
DTNVSHLLIIVSVTASAAVVIFNLVNCFICRWKRNKTIETKARAMARNNSYKSCSNSPGF
YPSDQLISVQDKWEIAPAFLTFGHQLGQGAFGRVLTGSYNGKRVAIKMTKKNAPPSYKED
LLAEICLMKKIGAHPNIVSLIGSCTVREPLALVMEYMPHGNLLHFLRRCRFEGQLKTEGA
KQKAIEYPMINEDGSIEQETITSKELLSFARQITLAMEYLSSKGIVHRDIAARNVLVGKD
KLVKLCDFGLSRDIYKELEYHKDTSGKLPLKWMAPESLKDCVYTVQSDVWTFGILLWEIA
TLGASPYPNIALPDLFSELDQGTRMSIPKNCSTELYILMLQCWHKVPKRRPSFTSLRLAL
EDMMSQDSDYLDLDNILESALEDERDDSVQECRVDIFADKTETLLPREREGQDEEEEIRD
QPFTRKRSLKQTLSQLSNILDSPNLLKKGSLKSQKSCGSNFGSPRLSIKGSIRRKMSIKH
SRSKENLIDDDDKDESGCESCSETQLNNLNEEDFSYQEQHLHALKSTHL
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctcaggagaataagcgttttattatttctcttctccactgggttgcagaca
actgtttccagtcatctgggactaggcgttgagctgggaaggtgtcgcactcgatgttta
cagtttctcactttggaagtgaacgatgaagaatgtcagaagaacgggaactgtaaaatg
tgctgggagacctgtgaattccttcagtgggagccaagcaagtggaatgtaatgtgtaat
gcacctcacatatgttttcctggttgtaagagctcttgtgaattctgggatcaccactct
acagcgataacacaaaatcccctttatgagcttctaaagcccatccaagtcaagaataac
aacggagctttacgcttagagtggataccacctgtttctgaaaaaaattcagagcgtttc
gtctatattttaagcagccgggatgttaatgatacttttagtgactggtatacagatatt
caaaccgctgacatgtgggttgagtatgaggccacctcgttttcgaacctgtcgaatacc
aagtatcaattccagttgattgtggttaacgaaaatggaactgtggcgatttctgagaca
gagacgctcgatctttctcatttacatgctccctcacatcagcctgacaacccacttaat
atctcagtgattgtagagagagacaacagttctacatttgcttatgtccactggcagcag
atgtctgcagaacgcactgattacagtgtcttctggggaatggaggactgcaacgtgaat
agatctctaccctactgcactatcccgcctgactactttgccacatatataacagacagc
ttggaaggggatgttgaagtcaagctgaatgcagatttaacattcaattcaaagtacttt
gtgcaagttgaatgcagcacaactggtatggtgtcccccaagattttcttctgcacccct
gggtgtgagaatccagaccctaccttcactgtgtgtctcccagatgaagttattgaaaaa
gaccataacactccctcacgtcagcctgacaacccacttaatatctcagtgattgtagag
agagacaacagttctacatttgcttatgtccactggcagcaaatgtctgcagaacgcact
gattacagtgtcttctggggaatggaggactgcaatgtggataaatctctacccttctgc
actgtcctgcctgactactttgccacatataaaacagacagcttggcaggggatgttgaa
gtcaagctgaatgcagatttgacttttaattcaaagtactttgtgcaagttgaatgcagc
acaactggtatggtgtcccccaagattgtcttctacacccctgggtgtgagaatccagac
cctaccttcactgtgtgtctcccagatgaagttattgaagaggacgataacattacagta
actgctactacctgggcccccatttgccataacctaacctatagccacagtgagaacaag
tgggcagtagtcatctcgtggcctccccctgcccaaggtgttcccattagatacaatgtg
tcctggatgacagacttcagagaaggcgacagcatgtacagtgcaggtcaaacatctact
acagagaaccatgtggtgctgatgttgcctggaggacaacattatgaagttttggttatg
gcagtttacagtgatccaaaagagtcccaatacagtgattacttgtatttcaatttatta
gccaaggttcctcaagttgaagcatccaagaatggtacaacagatgggattaaagtagag
gacaccaacgttagtcacttgctcatcattgtctcagtcactgccagtgctgcagtggtc
attttcaacctcgtcaactgttttatttgtcgttggaaacgtaacaaaaccattgagact
aaagcaagggccatggccagaaataacagttacaagtcttgctccaacagtcctggcttt
taccctagtgaccagttgatctcagtacaggacaagtgggagatcgcccctgcatttctc
acttttggtcaccagcttgggcaaggggcatttggcagggttcttacggggtcttataat
ggcaagagagtggccatcaaaatgaccaagaaaaatgctccaccttcttacaaggaagac
cttctggcagaaatctgcttgatgaagaagataggtgcccatcctaacattgtttctttg
attggctcctgtacagtgagagaacccctggctctagtaatggaatacatgccccacgga
aaccttctccactttcttagacgttgtcgttttgaaggtcagcttaagacagaaggcgca
aaacagaaagccattgaatacccaatgataaatgaagatggcagcattgaacaagaaacc
atcacatctaaagagttgctatcatttgcacgccaaattactctggccatggaatacctg
tctagtaaagggattgtccaccgtgacatagctgcccgtaatgtgttagtggggaaggac
aagctggtcaagctgtgtgactttggtttgtccagggacatctacaaagaactcgagtat
cacaaggacaccagtggtaagctgccgttgaagtggatggccccagagagtttgaaggac
tgtgtttatacagtgcagagtgatgtgtggacatttgggatcctgctatgggagatagcc
acactgggtgcttctccatacccaaacattgccctgcctgacctattctctgaactggac
cagggaacaagaatgagcatccccaagaactgttctactgaactgtatattctaatgctg
cagtgctggcacaaagtccccaagaggagacccagttttactagccttcgacttgcactg
gaagacatgatgagccaggacagtgattacctggaccttgacaacatcttggagtctgcc
ctagaggacgagagagatgactcagtgcaagaatgtagggtagacatatttgctgacaag
actgaaacattgctgcccagggaaagagagggccaggatgaggaagaggaaattcgagac
cagccattcacgagaaagcgcagcttaaaacagaccctctcccagttatccaacatccta
gattcaccaaacctattgaagaaaggcagcctgaagagccagaagtcatgtggttctaac
ttcggctccccaaggctgtccatcaaaggcagtatccgtaggaagatgtcgattaaacac
agccgatccaaggagaacctcattgatgatgatgacaaggatgaaagcggatgtgaaagt
tgcagtgaaactcagttaaataacctgaatgaagaggatttttcctaccaggaacagcac
ctacatgccttaaagtctacacatctttag

DBGET integrated database retrieval system