KEGG   Lingula anatina: 106154621Help
Entry
106154621         CDS       T04921                                 

Definition
(RefSeq) pancreatic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lak  Lingula anatina
Pathway
lak00500  Starch and sucrose metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    106154621
Enzymes [BR:lak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     106154621
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 106154621
NCBI-ProteinID: XP_013384479
UniProt: A0A1S3HHK8
LinkDB All DBs
Position
Unknown
AA seq 729 aa AA seqDB search
MAWTDKIVLFLLSLWAGISFAFHDPNCAPGRHVIVHLFEWKWSDIAAECERFLGPKGFCG
VQLSPPSEHIVSTNPSHPWWQRYQPVSYQLNSRSGNRAAFADMVSRCNNVGVRVYADIVV
NHMAAAGIGTGYGGSNYDSGSLSYPGVPFGPNDFNGPAECSTSSGNIENYGDANQVRNCR
LLGMPDLALGKDYVRGKVADYLNDLIGLGVAGFRIDAAKHMWPGDLAGILGRLNNLNTQW
FSSGKQPFVFHEVIDLGGEPIKGSEYKSMGRVTEFKYGKFLGKAFRGRDQLKWLETFGQS
WGMLHPFDALVFIDNHDNQRGEGGGGMDTIVTFFESRPYKMASAFMLAHPYGLPRVMSSY
HWDRHIVGGEDHNYWIGPPHNEDWSTKDVIMNADGTCGNGWVCEHRWRQIANMVAFRNAC
DGEEISNWWDNGNNQIAFSRGNKGFIAINNDGNGLDATLQTGLPAGLYCDVISGDFVNGG
CSGHTISVDGSGRAHISISNSAEDPFIAIHVGAKIGEDGGDEGGRETQPPAPAPTPGEGW
ARTVVFIKKQTQYGQDLFVRGGISHAHRTGCSQDAATSACAIPIVYNDLGDTDHLEKFNA
WRGGDSRLDWYGPEQGQGTFGSKTASGSPTVWTTNVQGEDGYFPDNRFGEHYWMLDINMD
CSKTEGGWFDIKSYLSDGSGGFWEADINQVTSCGGSAGGQAPYSSKNHVARCGYINVFEF
GSGSCIIDN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atggcgtggactgacaagattgtcctcttcctgctgagcctatgggcaggaatcagtttc
gctttccacgacccgaactgtgccccaggccgccatgttattgtgcatctgtttgaatgg
aagtggtcggacatagcggcagagtgtgaaaggtttctgggcccgaagggattctgtggc
gtacagctatcacctcccagtgagcacatcgtgtccaccaacccgagtcatccgtggtgg
cagcggtatcagccggttagctaccagctcaacagccgcagcggaaatcgggcagcattc
gccgacatggtttcaagatgtaataatgtcggcgttagagtctacgcagacatcgttgta
aatcacatggcagcagcaggaattggaactggttatggtggttcaaactacgactctggt
tcactcagctacccaggggttccgtttggcccgaatgacttcaacggaccggcagaatgt
tccactagcagcgggaacatagaaaactacggagacgcaaaccaagtccgcaactgtcgg
ctgcttggtatgcctgacttggcgctcggtaaagattatgtccgtggtaaagttgctgat
tatcttaatgacttgattggtctcggcgtggcgggatttcgtattgatgcagccaagcac
atgtggccaggagatcttgctggcattttgggtcggctgaacaatcttaatacgcagtgg
ttttcgtcagggaagcagccgtttgtttttcacgaagttatagatcttggtggggaacca
atcaaaggctctgaatataaatcgatggggcgagtgacagagttcaaatatggcaagttt
ttgggaaaggcttttaggggtcgcgatcaactcaaatggctggaaacgtttggtcaatct
tggggcatgctccacccttttgatgctctcgtatttatcgataaccatgacaaccagcgg
ggagaagggggcggaggaatggatacaatcgtgactttcttcgagtcccgaccttacaaa
atggccagtgcgtttatgctggcgcatccatacggacttcccagggtgatgagcagttac
cactgggaccgccacattgtaggtggtgaagaccacaattactggattggtcctccacac
aatgaggactggtcaactaaagatgtcatcatgaacgctgatggtacctgtgggaatgga
tgggtctgcgaacaccgctggcgccaaattgccaacatggtcgcttttcgcaacgcatgt
gacggggaggagatctccaactggtgggacaacggtaacaaccagattgcgttctcgcgt
ggaaacaaaggatttatcgcaattaataatgacggcaatggtttggatgcgacccttcaa
actggtcttccagctggcttgtactgtgatgttatttctggggattttgtgaatggtggc
tgttcgggccacaccatctctgttgacggaagtggcagagcacacatcagtattagtaat
tccgctgaggatccttttattgcaattcacgttggtgccaaaattggcgaagatggtgga
gacgagggcggcagagaaacgcaacccccggcacccgcacccaccccgggagaaggatgg
gcaagaacggtagtgtttatcaaaaaacaaacccaatacggacaagatttgtttgtaaga
ggaggcatcagtcatgctcaccgaacaggttgttctcaggatgcggcaaccagtgcttgt
gccatcccaatcgtgtacaatgatctaggagacactgaccatctcgagaagtttaacgct
tggcggggaggtgatagccgcctggactggtacggtcccgagcagggccagggtaccttc
ggtagtaagacggccagtggatcgccaactgtctggacaacgaacgttcagggagaggat
ggatatttccctgataataggtttggcgagcactattggatgcttgacataaatatggat
tgctctaagacagagggaggttggttcgacataaagagttacctctctgatggtagcggc
ggtttctgggaagctgatatcaatcaagtgacatcatgtggcggatcagcaggaggacag
gccccttatagctctaagaaccacgtggcacgatgcggttatatcaacgtgtttgaattt
ggcagtggaagctgcatcatcgataactaa

DBGET integrated database retrieval system