KEGG   Lingula anatina: 106155458
Entry
106155458         CDS       T04921                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lak  Lingula anatina
Pathway
lak04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    106155458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lak03000]
    106155458
Transcription factors [BR:lak03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    106155458
SSDB
Motif
Pfam: bZIP_1 bZIP_2 DivIC DUF4407
Other DBs
NCBI-GeneID: 106155458
NCBI-ProteinID: XP_013385780
UniProt: A0A1S3HI44
LinkDB
Position
Unknown
AA seq 634 aa
MSPGELGEFDFGPDWMETDGLRDPGDNSSDSGISSVSIKQEPFSPALSHTSDCSGDSFLQ
QTPLDQLPLLNQFDVKLESPPPTPPQDNSDSAVQYIQPSAISCGVTFQKGAAAAAQPAHS
KPHITTVKLTHVTGLNPDSKPLPPKVVNVLNSKVKIQPKLPNSSACVTPAPSPPPPTPPG
VAPGSPCAGSQGTAASKPLVLTAEEFARLTAQGVLKFHPPEQEANKTNSSVAQCIPVPQG
EDPRVWKRQQRMIKNRESASLSRKRKKEYMTTIENQLQEISRENEKLRQENQNLKRKLSL
LNSENMALKRSTGSTKVTATCLLTVLFMFALNLGPINNLVFKSSSETSLAAIPMSSVHPG
GGRHLLTYDETMQQPISGKYFPRSKASFEDIESTLAELKRGFEREKFFRKNKDFIAFNSE
LESLCPVYFNKTESQRLANELTGWVLAHKEAQKKKKILEENIREKKAVEAKNRKPTRKKY
VKPKTLHAMMKGDLDIKYAKDSYPGSSQYQVQVFNGPDKSYMDFLDSIHRRNDTFYVVSF
RRDHLLLPAVAHNKTMRPRMSLLMPALPLNETMQPPPGDMAMMQIDCEVMNTRLLHIKNT
AVPSFMKEPPSNVTHTVVTNTETPDHLPREEVIP
NT seq 1905 nt   +upstreamnt  +downstreamnt
atgagtcctggagagttgggggagtttgactttggtccagactggatggaaacagatggg
ttgagggaccctggggataacagcagtgacagtggcatcagcagtgttagtatcaaacaa
gaacctttctcccctgctctgtctcatacctcagattgctctggtgactccttccttcag
cagaccccccttgatcagctgccattgctgaaccagtttgatgtgaagcttgagagtcct
cctccaactcctccccaagacaacagtgacagtgcagtccagtatatacagccttcagcc
attagttgtggtgtcacattccagaagggggcagcagcagcagctcaacccgcacacagc
aagccacacattaccacagtaaaactgacacatgtaacgggactgaacccagacagtaag
ccactgccacccaaagttgtcaatgtgttgaattctaaagtgaagatacagcccaagtta
cccaatagttctgcctgtgtaacccctgcaccctccccaccgccaccaacgccacctggt
gtagcacctggctcaccctgtgcaggtagtcaaggcacagctgcctccaaacccctagtt
ctcacagctgaagagtttgcccggcttactgcccagggagtactgaagttccatccccca
gagcaggaggccaacaagaccaacagctcagtagcacagtgtatcccagtaccacaggga
gaggatccaagagtttggaaacgacaacagagaatgataaagaatagagaatctgcaagc
ttgtcaagaaaaaggaaaaaagagtacatgactacaatagaaaatcaacttcaagagatt
tcaagagagaatgagaaactcagacaagagaaccagaatttgaaaagaaaacttagttta
ttaaattcagagaacatggcattaaagcgcagcacaggttcaacaaaggtgacagccacc
tgcctacttacagttctcttcatgtttgccctcaatttggggcccataaacaatttagta
tttaaaagctcatcagaaaccagcctagctgccattccaatgagttcggtccatcctgga
ggtgggcgccatctattaacctatgatgaaactatgcagcagcccattagtgggaagtat
ttcccaaggagcaaagcaagctttgaagacattgagagcacattagccgaactgaagagg
ggatttgagagagaaaagtttttcagaaaaaataaagacttcattgcatttaatagtgag
ctggagtccctctgtccagtgtacttcaataaaactgaatctcaaaggctggctaacgag
ctgacggggtgggtcttggcacacaaagaagcccaaaagaaaaagaaaattttagaagaa
aacatcagggaaaagaaggctgttgaggccaagaacagaaaacctaccaggaagaagtat
gtgaaaccaaagacattgcacgccatgatgaaaggagatttggacattaaatatgcaaag
gatagttaccctggcagtagccagtatcaggttcaggtcttcaacggtccagacaaaagc
tacatggatttcttggactccattcacagaagaaatgacacattttatgtggtgtctttt
agaagggatcatcttctcttgccagctgtggctcacaataaaaccatgcggcccaggatg
tccctgttgatgcctgcactgccactgaatgagactatgcagcccccgccaggtgacatg
gccatgatgcagatagactgtgaggtgatgaacacgcgactcttgcacatcaagaacacc
gctgtgccgtcttttatgaaagaacctcccagcaacgtgacgcacactgtcgtaacaaac
acggagactccagaccatttgccgcgagaggaagtgattccataa

DBGET integrated database retrieval system