KEGG   Lingula anatina: 106155622Help
Entry
106155622         CDS       T04921                                 

Definition
(RefSeq) glutathione S-transferase U20
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lak  Lingula anatina
Pathway
lak00480  Glutathione metabolism
lak00980  Metabolism of xenobiotics by cytochrome P450
lak00982  Drug metabolism - cytochrome P450
lak00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106155622
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    106155622
   00982 Drug metabolism - cytochrome P450
    106155622
   00983 Drug metabolism - other enzymes
    106155622
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lak02000]
    106155622
Enzymes [BR:lak01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     106155622
Transporters [BR:lak02000]
 Other Transporters
  Pores ion channels [TC:1]
   106155622
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C GST_C_5
Motif
Other DBs
NCBI-GeneID: 106155622
NCBI-ProteinID: XP_013385982
UniProt: A0A1S3HIY8
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MSSQASDDRPHLYTAWHSPFGWRAWTSLLEKGVDFVYHETDPYDKSPEWFKISPRGLAPA
IHHKGRAVYESTVCIEYIDEAWPHEPRLMPSDPYDRAYVRMWADHVNKKIIPHIFGMIVK
QTPEEQEQAKKDALDGILAYTQAMRDGGPYFLGAQFSLADIVLGTFASIFFCMEHYRGFK
VPETEQFARYHTWINAVKSRESWQKVLPSREKVLEDWRPYAEGKAQTELAKAARQGKTP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtccagccaagcatctgatgacagacctcatctatacacagcctggcattcccccttt
gggtggagagcatggacctcccttctagagaagggggtggactttgtgtaccatgagaca
gacccttatgacaagtcccccgagtggttcaagatcagccccaggggactggctccggct
attcaccacaaggggagagctgtgtatgaaagcactgtttgcattgaatatatcgatgaa
gcatggccacacgaaccccgcctcatgccctctgacccctacgatagggcttacgtgcgc
atgtgggccgaccacgtgaataagaaaatcattccccacatttttggcatgattgtgaaa
cagacaccagaagaacaagagcaggctaaaaaagacgccctagatgggattttggcctac
acgcaggccatgcgcgatggaggtccttattttcttggtgctcagttttcattggctgat
attgttcttggcacttttgcatccattttcttctgcatggaacattatcgtgggttcaag
gtgccagagactgaacagtttgctcgctatcatacttggattaatgcagttaagagtaga
gaaagctggcagaaagtgctgccatctagggagaaggtgcttgaagattggagaccctat
gctgaggggaaggcccagacagagttggctaaagctgctagacaaggaaaaactccataa

DBGET integrated database retrieval system