KEGG   Lingula anatina: 106156139Help
Entry
106156139         CDS       T04921                                 

Definition
(RefSeq) glycolipid 2-alpha-mannosyltransferase-like
  KO
K10967  alpha 1,2-mannosyltransferase [EC:2.4.1.-]
Organism
lak  Lingula anatina
Pathway
lak00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    106156139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:lak01003]
    106156139
Enzymes [BR:lak01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     106156139
Glycosyltransferases [BR:lak01003]
 Glycan extension
  Yeast mannan chain
   106156139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_transf_15
Motif
Other DBs
NCBI-GeneID: 106156139
NCBI-ProteinID: XP_013386701
UniProt: A0A1S3HMH0
LinkDB All DBs
Position
Unknown
AA seq 369 aa AA seqDB search
MLNTLLLRRSRSRSFLLITALVICILTVTLIVRTQMRQKSVLRDFRNDQQLKEFQRVVST
WPNGKPKAVIYFLTYEASFWRMKVAVRHLDTYFNQNFQYPVVVFYEGNVTDRDLTDLTDI
STSRIFFQKIHFNQPYYLNVSVEEAVKDITCPKPDRSRFPGYNHMSRFHARLVAQQPILA
NITWYFRLDDDSLLQDYITYDIFRFMQDNHYTYGYNLVFFDNPLCLTYLKENITHYLKVN
SIEPKEYSDWPDGGIFYNNFEVSRFDFWRRPDVVRFLKFIDESGGIYHYRWGDAPIKSAA
VLIFLPRQQLYHFRKIKYYHGPWYPGFGETITLFEAIKWISVGSLSTCLVLVILLCCYLY
LRIRNKIIS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgttgaacaccctgctgctgcgtcgatcaaggtcacgctctttcctcttgataactgca
ctggtcatttgtatcctgaccgtcacattaattgtccgcacacagatgaggcaaaaatct
gttttgagggactttaggaatgaccaacagttgaaggagtttcagcgtgtggtcagcact
tggcccaatggaaagccgaaagcagtcatatattttttgacttacgaggcgagtttttgg
agaatgaaagtcgccgttcgtcatcttgatacgtattttaatcaaaattttcaataccct
gtggttgttttctatgaaggaaacgtcactgatagagatttgactgatttaacagatatt
tctacatcaagaatattcttccaaaaaatccacttcaaccagccctactacttgaatgtg
tcagtagaggaagccgtcaaggacatcacgtgtccaaaacctgatcggtcccgtttccct
ggttacaatcacatgagcagattccatgctcgtctggttgcccagcaaccgattctcgcc
aacatcacgtggtacttcagacttgatgatgattcgctacttcaggattacatcacatat
gatatattcaggtttatgcaggataaccattacacctacggatataaccttgtcttcttt
gacaatccgctctgcctcacttacctcaaggaaaatattacacactatttaaaagtgaat
tcaattgaacccaaagagtacagtgattggccagatggtgggatattttacaacaacttt
gaagtatcgaggtttgacttttggcgaagacccgacgttgtgcgttttttgaaattcata
gacgaaagtggtggaatttatcattataggtggggtgatgcgcctattaagagtgcagct
gtactgattttccttccgcgacaacaattgtatcactttcgaaaaattaagtattatcac
gggccctggtatcccgggtttggagaaacaatcacgttatttgaagcaattaaatggata
tcggtggggtcactgagcacgtgtctcgttttagtcattttgctatgttgttacctctat
ttaagaattagaaataaaataatttcttag

DBGET integrated database retrieval system