KEGG   Lingula anatina: 106157535Help
Entry
106157535         CDS       T04921                                 

Definition
(RefSeq) 3-ketoacyl-CoA thiolase A, peroxisomal
  KO
K07513  acetyl-CoA acyltransferase 1 [EC:2.3.1.16]
Organism
lak  Lingula anatina
Pathway
lak00071  Fatty acid degradation
lak00280  Valine, leucine and isoleucine degradation
lak00592  alpha-Linolenic acid metabolism
lak01040  Biosynthesis of unsaturated fatty acids
lak01100  Metabolic pathways
lak01212  Fatty acid metabolism
lak04146  Peroxisome
Module
lak_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106157535
   00592 alpha-Linolenic acid metabolism
    106157535
   01040 Biosynthesis of unsaturated fatty acids
    106157535
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    106157535
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    106157535
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     106157535
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 106157535
NCBI-ProteinID: XP_013388669
UniProt: A0A1S3HUD4
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MTDCRKVFFGQLSQSSAAVDVHTEPCMASRPGVESDDDIVILAARRTPIGKAKRGMLKDT
RPEDMLSTVFKALLEETKLDPRAIGDICVGNVLLPGAGALQARFGQFFSDIPETTPISAV
NRQCSSGLQAVMNVAGDIAMGVCDIGIGAGVESMSQRSIGDGQGQELSPKVFDIQIAQDC
LIPMGITSENVAERYGVDRKKQDAFSLLSQQRAATAASQGLFDAEIVPITTTVKDKNGDE
KTVTVSKDEGIRPTTAEGLAKLRPAFKPGGTTTAGNSSQVSDGAAAVLLARRSAAKKLGL
PVFGVIRSFAVVGVPPDVMGIGPAYAIPEALKKAGLTVDDIDIFEINEAFASQAVYCVEK
LGIPFEKVNPKGGAIALGHPLGCTGSRQIATALHEMKRRGKRGYAVISMCIGTGMGAAAV
IEYPGLKSHL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgacggattgccgtaaagtattttttggtcaacttagccagagcagtgcggcagttgac
gtccatacagagccttgcatggcaagccgaccaggggtggagagcgacgatgacatcgtt
attttggctgcccgaagaaccccgatcgggaaggctaagcgtggaatgttaaaggacaca
agaccagaagacatgttatctacagtgttcaaggctttgttagaagaaacaaaactggac
cccagggctattggagacatttgtgtgggaaatgtccttttgccaggggcgggagctcta
caggccagatttggtcagttcttcagcgacattccagagacaacccctatatctgcggta
aacagacagtgttcttcaggactgcaggccgtgatgaatgtggcaggagacattgcaatg
ggagtctgtgacattggcattggtgctggagtggagagtatgagccagagaagtattggg
gatggtcagggtcaggaactcagccctaaagtgtttgacatccagattgcccaggactgc
ctgattcctatgggaataacttcagagaatgtggccgaaaggtacggcgtagacaggaaa
aagcaagatgcattttctctcctatcacaacaaagagcggctacggcagcaagccaaggt
ctctttgatgctgagattgttcccattacaacaacagtgaaagataaaaatggagatgag
aaaactgttactgtgagtaaagatgaaggcatcaggcccacaacagccgagggattggcc
aagctccgtcctgctttcaaacctggcgggactacgacagcaggcaattccagccaggtt
agtgatggagctgccgcagttctccttgccaggcgttctgctgctaaaaaacttggcctt
cctgtgtttggggtaataagaagttttgcagttgttggagttccaccagacgtgatggga
ataggacctgcttacgccattcctgaggccctcaagaaggctggtctaacagttgatgac
attgacatctttgagatcaatgaggcctttgccagccaggcagtttactgtgtggagaaa
ctagggatcccctttgagaaggtcaaccccaagggtggggccatagctctaggacacccc
ctggggtgcactgggtctcggcagatcgccactgccctgcatgagatgaagagaagggga
aaacgaggttatgctgtgatctccatgtgtattggcactggtatgggggcagccgctgtg
atagaatacccaggactaaaaagtcatctttaa

DBGET integrated database retrieval system