KEGG   Lingula anatina: 106159237Help
Entry
106159237         CDS       T04921                                 

Definition
(RefSeq) hexokinase-2 isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
lak  Lingula anatina
Pathway
lak00010  Glycolysis / Gluconeogenesis
lak00051  Fructose and mannose metabolism
lak00052  Galactose metabolism
lak00500  Starch and sucrose metabolism
lak00520  Amino sugar and nucleotide sugar metabolism
lak01100  Metabolic pathways
lak01200  Carbon metabolism
Module
lak_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
lak_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106159237
   00051 Fructose and mannose metabolism
    106159237
   00052 Galactose metabolism
    106159237
   00500 Starch and sucrose metabolism
    106159237
   00520 Amino sugar and nucleotide sugar metabolism
    106159237
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    106159237
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lak04131]
    106159237
Enzymes [BR:lak01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     106159237
Membrane trafficking [BR:lak04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    106159237
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 FGGY_N
Motif
Other DBs
NCBI-GeneID: 106159237
NCBI-ProteinID: XP_013390906
UniProt: A0A1S3HZA7
LinkDB All DBs
Position
Unknown
AA seq 475 aa AA seqDB search
MTSGMMAPLDRFRSWVKRRVKQWKVERIVEELKLSDVQLRKVMQLLDDEMNKGLCKGTNP
NAAIKMFPTYVRSIPDGTEEGNYLALDLGGTNFRVLLIRLNGSEVSMRSKIFLVPNFIMT
GTAEELFDHIAECISKFMHEEGIADQKLPLGFTFSFPCKQEGLARARLSQWTKGFKVSGV
EGEDIVRLLHEAIERRDDIDVECVAVINDTVGAQISCAHEDRNCQIGLILGTGSNACYME
QLDKVETWDGDERAPRQVIINTEWGAFGDNGVLDFIRTQYDQELDAKFSVNPGKQLYEKM
MSGMYLGELARLYLERLVNEGLLFEGQSSDLLSTPGRFYTKYISEIESDKRDDFKNTKSV
LEYDLGIENYSNADCHYVQYVCSLVSSRAAHLASCGCAVLLNRVARPSVTIAVDGSLYRF
HPKFGDIMEQKVSQLVNKGLKFKIMLSHDGSGKGAALVAAVACRIRDEQKRNGLI
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaccagtggcatgatggcccctctggacagattcaggtcctgggtgaagaggagagtg
aagcaatggaaggttgaaagaatagtggaagagctaaagctctctgacgtgcagctacgg
aaggtgatgcagctcttggatgatgagatgaacaagggtctgtgtaaaggaacaaatcca
aacgcagctatcaagatgttcccaacatacgtcagatctatacctgatggcacagaggaa
gggaactacttggccctggatctcgggggcaccaacttcagagtgttgctgatcaggctg
aatggttccgaggtgtccatgaggagtaaaatcttcttggttccaaacttcatcatgaca
ggaacagcggaagagctctttgaccacatagcagagtgtatctccaagttcatgcatgag
gagggtatagctgaccagaagctgcccctggggttcacattttcattcccgtgtaaacag
gagggtctggccagggcccgtctgtcacagtggacgaaggggttcaaggtcagcggagtg
gagggagaagacatcgtgagactgctacacgaggctattgagaggagggatgacattgat
gtggagtgtgtagcggtgataaatgacacagtaggagcacagatatcttgtgcacacgaa
gacagaaactgccagattggacttattttaggcactggtagcaatgcttgctacatggaa
cagttagacaaagtggagacatgggatggtgatgagagagcacccagacaggttataatc
aacacagagtggggagcatttggggacaatggtgttctggattttataagaacacaatat
gatcaggaattagatgcaaaattctcagtcaacccaggaaaacagctgtatgagaagatg
atgtcgggtatgtacctgggagagctagcgcgcctctacctggagcgtttggtcaacgag
ggactgctcttcgagggacagagctccgatctcctatcaactccagggcgcttttataca
aagtacatctcagaaattgaaagtgacaagagggatgattttaaaaataccaagtctgta
ctagagtatgaccttgggattgagaattacagcaatgcagactgccactatgtgcaatat
gtttgttctttagtatccagccgagcagcccatttagcttcatgtggctgtgcagtacta
ctgaacagagtagcccggcccagcgtcacaatagcggtggacggctctctatacagattc
catcccaaatttggtgatatcatggagcaaaaggtctcacagttggtcaacaaagggtta
aaattcaaaatcatgttatctcatgatgggagtggaaaaggtgctgcgttagtggcggcc
gttgcatgcaggatacgtgatgaacaaaagaggaatggactaatatga

DBGET integrated database retrieval system