KEGG   Lingula anatina: 106161466Help
Entry
106161466         CDS       T04921                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial isoform X1
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lak  Lingula anatina
Pathway
lak00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    106161466
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     106161466
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C EF-hand_7 FAD_binding_2 EF-hand_6 EF-hand_1 FAD_oxidored EF-hand_8 GIDA Pyr_redox_2 FAD_binding_3 EFhand_Ca_insen HI0933_like
Motif
Other DBs
NCBI-GeneID: 106161466
NCBI-ProteinID: XP_023932590
UniProt: A0A1S3I9U9
LinkDB All DBs
Position
Unknown
AA seq 725 aa AA seqDB search
MSRWNSAKRLVLYGLAAGGVGTASVYMISNRRKHIAQDNPNVSAERLNQPLPTREEQLAS
LENDQFDVLVIGGGATGAGVALDTTSRGLKTALVEKFDFSSGTSSRSTKLIHGGVRYLQK
AVFNLDLEQYRMVKEALAERANLLKIAPHLSYPLPIMLPIYKWWLVPYYWAGIKCYDLVA
GKQTLKSSYLLSKSQALELFPMLKKDQLVNALVYYDGQHNDARMNIAIALTAARLGASIA
NHVEVTEILKSEDENGKLVCSGAKMKDRITGKEFEVKAKCVINATGPYTDLIRTKDDKTI
PKICQPSSGVHVVLPDYYSPERMGLLDPSTSDGRVIFFLPWQKATLAGTTDRKCEVTDNP
SPSEEEIAFILREIQKYLGPDVEVRRGDVLSAWSGIRPLVLDPNAKDTQSIARNHIIEVS
GTNLITIAGGKWTTYRSMAEETVDKAIAVCNLKPKNGCVTKGLLLDGAAGWTPTMFIKLV
QDFGLENEVAQHLADTYGDKAFKVAKMCSLTGKRWPVVGKRLHEEFPYLEAEVRYACREY
ARTAVDVIARRTRLSFLNVHACEESLPRIVEIMGEELGWNAAKKKEEIEHATVFLRKEMG
LQLGKGLRDIPVNLSKGDIDKYMKKFRELDGDNKGYITVNDIRKHLKEEPDLYLRKSGER
VTGEQLHDILNDVDLAKNGQVSTGEFLQLMHAIQTGAVAHSRLATATGLDKERKAIPVNR
SGGGV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgtccaggtggaattcagcaaaacgccttgttttatatggcctagctgcaggtggcgtt
ggaacagcatcagtatacatgatatcaaataggaggaagcatattgcacaggataaccca
aatgtatctgctgagaggttgaaccagcccctgcctacaagagaggaacaactggcctcc
ctggaaaatgaccagtttgatgtgttggtgataggaggaggagccacaggggcaggagtt
gctttagatactacaagcagaggtttgaagactgcccttgtggaaaagtttgatttttct
tctgggacaagcagtcgcagtacaaagttaattcatggaggagtgcgttacctacaaaag
gcagtttttaatttggatttggaacagtaccgaatggtgaaagaagccttagcagaaagg
gcgaacctcctaaagattgctccacatctctcgtatccattgcccattatgttgcctatc
tacaaatggtggcttgttccttactactgggcaggaatcaagtgctatgatttggtggca
ggaaaacaaacactgaaatcaagttatctgctttcaaagagtcaagccttagaactattt
ccaatgttgaagaaggaccaattggtgaatgctttggtgtattatgatggtcagcataat
gatgccagaatgaacattgccattgccctaactgctgctagacttggggcctccattgcc
aatcatgttgaggtgacagaaattttgaaaagtgaagatgaaaatgggaagcttgtctgc
agtggtgccaagatgaaagaccgcattacaggcaaagagtttgaggtcaaagctaaatgt
gtgatcaatgccactgggccatacacagatttaatcagaactaaagatgacaaaacaata
cccaaaatttgccagcccagttcaggagttcatgttgtactaccagattattacagccca
gagagaatgggtctcctagatccatctaccagtgatggcagagtaattttctttttacca
tggcagaaggccactctggcaggtacaactgataggaaatgtgaagtcacagacaaccct
agtccatcagaagaagagattgcttttattttacgtgaaattcaaaaatatcttggccca
gatgtagaagtgcgccgtggtgatgtgctgtctgcatggagtggcattagacccttggtg
ttagaccccaatgctaaagatactcagtctattgccaggaatcacattattgaagtcagt
ggaaccaacctcatcactattgcaggtggtaaatggacaacttaccgcagtatggcagag
gagactgtggacaaggccatagctgtctgcaatctcaagcccaaaaatggatgtgtgact
aagggcctgttacttgatggtgctgctggctggactcctactatgtttatcaagctggtg
caggattttggtctggagaatgaggttgctcaacacctcgctgacacctatggtgataaa
gctttcaaagtagctaagatgtgctctctgactggaaagaggtggcctgtggtgggcaag
agattgcatgaagagttcccttatttggaggcagaggtccgttatgcgtgtcgtgaatat
gcaaggacagctgtggatgtgattgcacggcggacaagactctccttcctaaatgtccat
gcctgtgaggagtccttgccaagaattgtggaaattatgggagaagagttgggttggaat
gctgcaaaaaagaaggaggaaattgagcatgccacagtattcctcagaaaagaaatgggt
ctacagctaggcaaaggactgagggatatacctgtcaaccttagcaagggagacatagat
aaatacatgaagaagttccgtgagctagatggagacaacaagggctacattacagttaat
gatatcaggaaacatttgaaggaagagccagatttatacttaaggaaatctggtgagcgt
gtgactggtgaacagctccatgatattctcaatgacgtggaccttgctaaaaatggacaa
gtttccactggagagtttttgcagttgatgcatgccattcaaactggagctgtggcacac
agtcgtttagctactgccactgggttagacaaagagaggaaagccatccctgtcaaccgc
agtggtggaggggtgtaa

DBGET integrated database retrieval system