KEGG   Lingula anatina: 106161988Help
Entry
106161988         CDS       T04921                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lak  Lingula anatina
Pathway
lak00052  Galactose metabolism
lak00500  Starch and sucrose metabolism
lak01100  Metabolic pathways
lak04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106161988
   00500 Starch and sucrose metabolism
    106161988
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106161988
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106161988
Enzymes [BR:lak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106161988
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106161988
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 DUF3357
Motif
Other DBs
NCBI-GeneID: 106161988
NCBI-ProteinID: XP_023930007
UniProt: A0A2R2MIX6
LinkDB All DBs
Position
Unknown
AA seq 1024 aa AA seqDB search
MEKKALYLDDPSARIAQEKHRPRRPARYLLVAMSVTLFLLATVVLANGCLRLRHDQQDSS
RKDLGSDQSIPDRYEGYRQVILQFFSYSEKADTQHGNDVGLISTQHKPIDNGLSRIVPQL
NQFIAEPAERRAQKIDFQAQRKTKDPLTFARIESNAVRSVENDLPPGCSVPNPSKIDCYP
GGGASQQACEARGCCWVPVNPNPGNAPWCFYKADNNATYSMGPVVKTPFGFSASLTKQKK
SQRWPNDILSLKLDVYLATQNRLHFKIYDPKNERYEVPIQTPPEPKRASTLDYDVTFNKN
PFAIMVKRKSTGTMMFDSSHGLLTFADQFLQISTSLPTQYIYGLGEHRDSLLHDATKPHT
FGFYARDQPPSERINLYGVHTLYIGLENDGSAFGVFLLNSNAMQVDMTPGSPPTLTYTTV
GGILDFYVFTGPTPNDVIAQYTAVIGRPTLPPYWSLGFHLCRWGYGGTDGMRKVIQRMRA
AKMPYDTQWNDIDYMDIHEDWSYDKKNFAGLPDVVKDLHQNGQHYVMIVDPGISNQKGYE
PYDSGVKAGVFIMDANGTAPIIGKVWPGTTAYPDFTNPAAVDYWVREAKGYHDQVPFDGI
WCDMNEPSNFVKGSINGCPKSKWDNPPYFPPAVAGGSPSDKTICGSAVQKAGRHYDLHSL
YGHTEGIASKKAVVTITGKRGLIISRSTFPSSGVYVGHWLGDNNAQEHDLQSSIPGVLNF
NFFGIPLVGADICGFQGDTNTNLCTRWMQAGAFYPFMRNHNTKGAKDQDPANPDFGKAAQ
DAIRNVLLVRYRLLPFLYTLFFQASVNGTGVARPLFFKYPTDPATYGIDQQFMWGDSLLI
SPVLANVDQARSVQAYLPNDVWYDFFNGSLLTSNGGQVALDAPLDKINLHVRGGSIIPTQ
EPDVTTTLSRRNKFGLLVALSPKEDSTGMLFWDDGDSVNPLGRGEYNLITFTAGKGGVNS
MVLKSGYKTTMTLGSATIFGVASAPSTVTANGKAAKFSYNTLTKTLNINDLSLSLLQPVK
LAWT
NT seq 3075 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagaaagcgctatatttagatgacccgagcgcccgcatagcacaggaaaaacat
cgtccgcggaggcctgcccggtacttgctggtagcaatgagtgtcaccctgttcctcttg
gcgacggtggtgttggcaaacggctgcttacgacttcgccacgatcaacaggactccagc
agaaaagatctcgggtcggaccaatccatccctgatcgatatgagggctacagacaggtg
atcctgcagtttttcagctatagtgaaaaagcggacacgcaacatgggaacgacgttgga
ctcatttccactcaacataaacctatcgataacggcttaagtagaatcgttccacagctc
aatcaatttatagccgaacctgcggagaggagggcacaaaaaatagacttccaagctcaa
cgaaaaaccaaagatcccctaacttttgccaggatagagtcgaatgctgtgcgctctgta
gaaaacgacctgcccccgggatgctccgtgccaaaccccagtaagatagattgttaccca
gggggaggggcctcgcagcaggcatgtgaggcccgggggtgctgctgggtgcccgtgaac
ccaaatccaggaaacgcgccgtggtgtttttacaaagccgacaataacgccacctattcc
atgggccctgtcgtcaaaacccctttcggcttctcggcaagtctcacaaaacagaagaaa
tcccaacgctggcctaacgacatcctcagtctcaaactggacgtttatttggctacgcag
aacaggttgcactttaagatatatgatcccaaaaatgagcgttatgaagttcccattcaa
acccctcccgaacccaaaagggcctcaaccttggactatgacgtcacatttaataagaat
ccgtttgctattatggtgaagaggaagagcacgggaacgatgatgtttgactcttcacac
ggcttgctgacatttgccgaccaatttctccaaatttccacctcccttcctacacagtat
atctacggcctaggagagcacagggacagtctgctgcacgatgccacgaagcctcacaca
tttggcttctacgccagggaccagccaccttctgaacgtataaacttatatggagttcac
acactatatattggtctggagaatgatggcagcgcattcggtgtctttctgctcaacagc
aacgccatgcaggttgacatgactcccggttctccaccaacattgacatataccacagtc
ggtggtattctggatttttacgtgttcaccggccccacccctaatgacgtcattgctcaa
tacacggctgtgattggtcggcccactttgcccccatattggagtctcgggtttcatcta
tgtcgttggggatatggcggaacagatggtatgaggaaagtgatccagcgcatgcgtgct
gcaaagatgccttatgacacccagtggaacgacatcgactacatggacattcacgaggac
tggagttacgacaagaagaacttcgctggactgccggacgtggtcaaggatttacaccaa
aacggccaacattacgtcatgatcgtagaccccggtattagtaatcaaaaaggatatgaa
ccgtacgacagcggcgtgaaggcgggagttttcattatggatgccaacggaacagctccc
atcattggcaaggtatggcctggcaccacagcatatccagacttcaccaatccagccgcc
gtggactactgggttagagaagccaagggttaccacgaccaggtcccatttgacgggata
tggtgtgacatgaacgagccttccaatttcgtcaagggatccatcaacggttgtcctaaa
tccaaatgggacaaccctccttacttcccgccagcggttgctggtggctccccctctgac
aagacgatctgtggttctgcagttcaaaaagcaggcagacactacgacttgcatagctta
tacggccacacggaagggattgcttccaagaaagcggtggtcacaatcacgggtaaacgt
ggccttatcatctcccggtcgacattccccagttccggcgtgtacgtggggcactggttg
ggggataacaacgcccaggaacatgatctgcagtcttccattcctggtgtacttaatttc
aacttcttcggcattccactggttggtgcagatatctgcggttttcaaggggacaccaac
accaacttgtgtaccagatggatgcaggcaggtgccttctaccccttcatgaggaatcac
aataccaaaggagctaaggatcaagatccagccaacccagacttcggcaaagccgcccag
gatgcgatcaggaacgtgttgctggtccggtatcgcctgttgccattcctgtacacgttg
ttctttcaggctagtgtcaacggcactggggtagcacgtccgcttttcttcaaatatccc
accgaccctgcgacgtatggcattgaccagcagtttatgtggggcgattccttactcatt
tcacccgttttagccaacgtggaccaagccagatctgtccaagcctacctgcctaacgac
gtgtggtatgacttctttaacggttcactattgacaagtaacggtggccaggtggcgctg
gatgcccccctggacaagataaacctgcacgtgagaggaggcagtattatccccacgcag
gaaccagacgttaccacgacgctaagccgccgaaacaagtttggtcttctggtcgcgcta
agtccaaaagaagattccacaggcatgctcttttgggatgatggcgactctgtcaatcca
ttgggtagaggcgaatacaacctgataactttcacggctggcaagggcggtgtaaactct
atggttctgaagtcgggatacaaaaccacgatgactctggggtccgccactatatttggg
gtggctagtgcgccctctacagtgacggctaacggcaaggccgccaagttcagctataac
acactgactaagaccttgaacatcaacgacctgtcgctctctttgctgcaacctgtaaag
cttgcgtggacgtaa

DBGET integrated database retrieval system