KEGG   Lingula anatina: 106161992Help
Entry
106161992         CDS       T04921                                 

Definition
(RefSeq) trypsin
  KO
K01362  ovochymase [EC:3.4.21.-]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lak01002]
    106161992
Enzymes [BR:lak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     106161992
Peptidases [BR:lak01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   106161992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin CUB PT DUF1986
Motif
Other DBs
NCBI-GeneID: 106161992
NCBI-ProteinID: XP_013394531
UniProt: A0A1S3I9J5
LinkDB All DBs
Position
Unknown
AA seq 445 aa AA seqDB search
MWLKIAIVMGCWSVLVSAKPAGRIDRVARQTTFPDACYAGSRPEVLTESDASKDIAIVDY
ENDMRCKWRIAAGEGERVRLTVLSYSIEDHGTCKFDRLLVRDGFNNKAPRLAKICGNSTG
VEVYESTGNYMFLLFRTDESVTDSGFGAFWEVITNGTNPTDAPTDAPTDAPTNAPTQAPT
NAPTNAPPSGDCANCGRRGTAVSASIVGGQEATPHSWPWMVALTNGFGGGQFCGGTLIDP
EWVMTAAHCTGGTIVVRLGEHDLSATENPNLVVEKRVIRTIDHPNYNGNSLDNDISLLKL
ESAVTLGTGINIACPPEPNSELTDGHYCVTTGWGATGSGQSGSDKLLEVDVPYISTATCR
ADSAYGNQVLDSMICGGTMAGGKDSCQGDSGGPYVCRFMDDNGQAFWKAYGVVSWGYGCA
QANRPGVYSKVSIYTEWIKNTMNSN
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgaagatagccatagtgatgggctgctggtcagtcctggtttcagctaaaccc
gccgggcgtattgaccgagttgcacggcagacaacgttcccggacgcctgttacgcaggc
agccgtccagaagtgctgaccgaaagcgacgccagcaaagacattgctattgtcgactac
gagaatgacatgagatgtaaatggagaattgcagccggagaaggagagagagtccgtctg
actgttctcagctacagtatagaagaccacggcacttgcaaattcgacaggctgctggtt
cgcgacggcttcaacaacaaggctcctcgcttggccaagatttgcgggaacagcacaggc
gtagaggtgtatgaaagcacgggcaactacatgttccttctctttagaacagacgagtcg
gtgacggattcaggatttggcgcgttttgggaggtgattaccaatggcactaacccaact
gacgctccaactgacgccccaactgacgccccaaccaatgcaccaacccaggccccaact
aacgccccaactaacgcacccccttctggagattgtgcgaactgcggaaggcggggcact
gcggtctcggcatcaatcgttggcgggcaggaggccacgccccactcctggccctggatg
gtggctctgaccaatggctttggcggtggtcagttctgcggtggaactcttattgaccct
gaatgggttatgacggcagcccattgcacaggagggaccatcgtcgtcaggcttggagaa
cacgatctgtccgccacagagaatccgaacctggtggtggaaaaacgtgttatcagaaca
attgaccatcccaactataatggaaactctctggacaacgacatttcgttgttgaaactg
gaaagcgccgtgacgctcggaactggcatcaacattgcctgcccccctgaacccaactcc
gaactgaccgatggccattactgtgtgacgactggctggggcgcaacaggcagcgggcaa
tctggaagtgataaactattggaggtggatgtcccttacatctccaccgccacgtgccgc
gccgatagcgcgtacgggaatcaggtccttgacagcatgatttgcggcggaaccatggca
ggcggcaaggactcttgccagggagattctggcggcccctacgtttgccgcttcatggat
gacaacggtcaggcgttctggaaggcttatggtgtcgtcagctggggttatggctgtgcc
caggcaaacagaccaggtgtctactctaaggtgtccatatacaccgaatggatcaagaac
acgatgaacagcaactga

DBGET integrated database retrieval system