KEGG   Lingula anatina: 106162221Help
Entry
106162221         CDS       T04921                                 

Definition
(RefSeq) glutathione S-transferase omega-1 isoform X1
  KO
K00310  pyrimidodiazepine synthase [EC:1.5.4.1]
Organism
lak  Lingula anatina
Pathway
lak00480  Glutathione metabolism
lak00790  Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    106162221
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    106162221
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.4  With a disulfide as acceptor
    1.5.4.1  pyrimidodiazepine synthase
     106162221
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3 Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 106162221
NCBI-ProteinID: XP_013394868
UniProt: A0A1S3I9E2
LinkDB All DBs
Position
Unknown
AA seq 261 aa AA seqDB search
MWLGGSKQLPFLQGKARSVLDLDTHKFHGSALPPLTPGRLRLYSMKFCPFAQRTRLVLVH
KNIPHEVINVNLKHKPKWLFEKNPKGLVPILEQDNRIVFESLICDEYLEDMYPEKPLRPS
DPYIKARQNILEGYFEQVLRSLYSTMFTRNPEKKLRGRENLLKSLEIYETELEGKFYGGD
EVGMLDFHLWPWIERIYTISHITGLEFSVEKFPKMNAWIQRMYQTPAVKATALPGEVHAA
FLKSLMDRSPNYEIEVPASRL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgtggctagggggttccaaacaactgccctttttgcagggaaaagctaggtctgtcctt
gatctagatacacacaagtttcatggctcagcattacctccactgactccaggaagactg
aggctgtatagtatgaaattttgcccctttgcacagcgaacaagactggttctggtacat
aagaacatcccccatgaagtgattaatgtcaacttgaagcacaaacccaagtggttgttt
gaaaagaatccaaaaggactggtgccaatactggagcaagacaacaggattgtgttcgag
tctttgatatgtgatgaatacctagaggacatgtacccagagaagcctctcagacccagt
gatccatatattaaggccaggcagaacattttggaaggttactttgagcaggtccttcgt
agcctgtacagcactatgtttacaaggaaccctgagaagaaactgaggggaagggaaaat
ttactgaaatccctggagatatatgaaactgaactggaggggaaattctatggaggtgat
gaagttggcatgctggactttcacttgtggccatggatagagcgtatctacaccatatca
cacatcacagggctggaattttctgtggaaaaatttcccaagatgaatgcttggatccaa
aggatgtaccaaacaccagcagtcaaagccacagctctgccaggagaggtacatgctgcc
tttttgaagtcattaatggacagatcgcctaactatgagatagaggtgccagcttcccga
ctgtga

DBGET integrated database retrieval system