KEGG   Lingula anatina: 106162681Help
Entry
106162681         CDS       T04921                                 

Definition
(RefSeq) phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
lak  Lingula anatina
Pathway
lak00562  Inositol phosphate metabolism
lak01100  Metabolic pathways
lak04068  FoxO signaling pathway
lak04070  Phosphatidylinositol signaling system
lak04140  Autophagy - animal
lak04150  mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    106162681
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106162681
   04070 Phosphatidylinositol signaling system
    106162681
   04150 mTOR signaling pathway
    106162681
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    106162681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:lak01009]
    106162681
Enzymes [BR:lak01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     106162681
    3.1.3.48  protein-tyrosine-phosphatase
     106162681
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     106162681
Protein phosphatases and associated proteins [BR:lak01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    106162681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase
Motif
Other DBs
NCBI-GeneID: 106162681
NCBI-ProteinID: XP_013395488
UniProt: A0A1S3IBE2
LinkDB All DBs
Position
Unknown
AA seq 470 aa AA seqDB search
MGQCYCQQETVEEEAESLTSNPVESRQDRRRTENFTNKSADMSTNMANRIKGLVSKKKRR
YQDDGFDLDLTYICPNIIAMGFPAERLEGVYRNNIDDVVRFLEQKHKGHYKVYNLCSERN
YDPSKFHQRVATFPFEDHNPPNLELIRPFCEDVDAWLSQDDRNVTAIHCKAGKGRTGVMI
CAYLLHRGKFDSVGDALKFYGQARTRDEKGVTIPSQRRYVEYYGNLVRRGLHYKPVTLLL
RKIRFETIPNFNGGTCTPFFVVSQLKVKIYTSRVYDTIKKGQQYFEMEIFPPIPVCGDVK
IEYFNKPKMIKKEKMFHLWFNTFFVEDREEVVQSNGNGQFGCNYGSQGSIGSGSQQGSST
SSQQWCGPNTTVTAPGPTSYLTAEFAKDEIDKANKDKSHKIFSPNFKLKLYFTSPEDADQ
IDDPLGENRMAEAAMESVAFHSSSDNEVLDENLSDTDTDNEWEGCEVTHV
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgggccaatgctactgccaacaagaaaccgtagaagaagaggccgaatcgctaactagc
aacccagttgaaagccgacaggatcgtcggcgaactgaaaacttcaccaacaaatctgca
gatatgagcaccaacatggcaaatcgcatcaagggattagtgagtaagaagaagagaaga
tatcaggacgatggtttcgacctagacttaacgtatatctgtccaaatataattgccatg
ggatttcctgcagaaaggttagaaggagtgtacagaaataacattgatgatgttgtcaga
tttcttgaacagaagcacaaaggacactataaagtatacaacctttgttctgaaagaaat
tatgacccctccaagttccaccagcgggtggctacatttccatttgaagaccacaaccca
cccaatctagagctgataagacccttttgtgaagatgtggatgcttggttatcacaggat
gacagaaatgttacagcaattcattgtaaagctgggaagggtagaacgggtgttatgatc
tgtgcttacctattacacagagggaagtttgacagtgtaggtgatgccttgaaattttat
ggacaggcaaggaccagggatgaaaagggggtaacgattccaagccaacggagatatgta
gagtattacggaaatttggtgcgaaggggtctccactacaaaccagtcactctattatta
cggaaaattagatttgaaacaattcccaattttaatggaggcacttgtactccattcttt
gttgttagtcagttaaaggtgaagatatatacatcaagagtgtatgatacaatcaaaaag
ggccagcagtattttgaaatggaaatctttccaccaattcctgtgtgcggagatgtcaaa
atagaatattttaataaaccaaaaatgataaagaaggaaaaaatgttccatttatggttc
aacacattctttgtggaggatcgtgaggaagtggtccaaagtaatggcaatggtcagttt
gggtgtaactatggttcccaaggttccattgggtcagggtcgcagcaggggtccagtaca
agttcacaacagtggtgtgggcctaataccacagtcacagcaccaggaccaacatcttat
cttactgcagagtttgctaaagatgaaatagacaaagccaataaggacaagtcacacaaa
atcttcagtccaaactttaagttaaaactgtattttacatcaccggaagatgctgaccaa
atagatgatccactgggagagaacaggatggcagaagcagccatggaatctgtagctttt
catagtagcagtgacaatgaagttttagatgagaacctctcagatactgacacagacaac
gaatgggaaggatgtgaagtgactcatgtatga

DBGET integrated database retrieval system