KEGG   Lingula anatina: 106163074
Entry
106163074         CDS       T04921                                 

Definition
(RefSeq) adenosine receptor A2b
  KO
K04291  lysophosphatidic acid receptor 2
Organism
lak  Lingula anatina
Pathway
lak04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:lak00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    106163074
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:lak04030]
    106163074
G protein-coupled receptors [BR:lak04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    106163074
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 106163074
NCBI-ProteinID: XP_013395998
UniProt: A0A1S3ICV5
LinkDB
Position
Unknown
AA seq 398 aa
MMDAEQENITSLSEDTFDGFLDNANFSLSQNQSDTGASWLIFASVGLAITVTGFLENVVS
ILALSHMRRPLEPFHYLLVNLAIADLIVVGFASIGNALFLYAQTVDRSSDTFCWAHFFME
ISYISLPSTLLATSALVFNQYLAVSKILNYRSMVTKRKVVFCITLFWICTIAIGAALQAV
TAYRNRSTLPENADGHFWDTLCAIYDTQDYYTFSAYTYFILFIVITTLVAIVYAKTYFDI
KHQLSGVRNLRRSIRRTRSSAEFEATQQTKVNATIALLFGTIVIFWLPGIADALITVYLL
SIAQDCQPCKIIHQITNLMFIANALLDPVIYGVRINQVRGGYHRLLKRCTKVLCRQSRAA
NVNGLGRQGALTSLGYERTSLYERANNGMVFSTNSTSL
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgatggacgccgaacaggagaatattacatcattgagtgaagacacgttcgatggattt
ttggataatgccaatttctctctgtctcaaaaccagagtgatacaggagcatcttggctc
atctttgcctctgtcgggttagcaattaccgtgacaggcttcctcgaaaatgtggtgagc
attcttgctttgagtcacatgcgacggccgttagagccattccattatttactggtcaat
ttagccatagctgaccttattgttgtgggttttgcgtccattggtaacgcgttgttttta
tacgctcagacggtggaccgctcctcggatacgttttgctgggctcattttttcatggag
atttcttatatatccttaccgtccaccttgcttgcgacgtcggcactggtgtttaaccag
tatctagctgtgtccaaaatactaaactatagatcaatggtgacaaaaagaaaagtggtc
ttttgtattactcttttctggatatgtactattgctatcggcgctgcccttcaagctgtt
accgcatacaggaacagaagtacattgccagaaaatgcagatggacatttttgggacacg
ctatgcgcaatatatgacacccaggattattacacgttttctgcgtacacatactttatt
cttttcatagtcataaccacacttgttgccatagtgtatgcgaaaacatactttgacatc
aaacatcaactttcgggggtgaggaacttaagacgctccattcgtagaaccaggagcagt
gcggaattcgaagccacgcagcaaaccaaagtgaacgctaccattgcacttctgttcgga
actattgtgattttttggttacctgggatcgctgatgctctgataaccgtttatcttcta
tccatagcgcaagactgccagccttgcaaaatcattcatcaaataaccaacttaatgttc
attgcaaatgctcttttggacccggttatttatggcgttcgtattaatcaggtgagaggt
ggttatcaccgattgttaaaaagatgcaccaaggttttgtgccgccaatcacgggccgcg
aacgtgaatggcttgggacgccaaggagcattaacatcgcttgggtatgagcgaacgtca
ctgtatgagagggcaaacaatggtatggttttctccactaattcaacgtctctttga

DBGET integrated database retrieval system