KEGG   Lingula anatina: 106166829Help
Entry
106166829         CDS       T04921                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lak  Lingula anatina
Pathway
lak00020  Citrate cycle (TCA cycle)
lak00190  Oxidative phosphorylation
lak01100  Metabolic pathways
lak01200  Carbon metabolism
Module
lak_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lak_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lak_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    106166829
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    106166829
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     106166829
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 106166829
NCBI-ProteinID: XP_013400938
UniProt: A0A1S3IS89
LinkDB All DBs
Position
Unknown
AA seq 660 aa AA seqDB search
MAAVLKVSSQLVKNIAIKTPIASTSTATRKLHFGPSVNTDVKTGQISKDYQVIDHTYDAV
VVGAGGAGLRAAFGLANQGFKTACISKLFPTRSHTVAAQGGINAALGNMEEDDWKWHMYD
TVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRLENGKIYQRAFGGQSLKYGKGGQ
AHRCCCVADRTGHSLLHTLYGRSLKYDTNYFIEYFALDLLMEDGECRGVLAFCLEDGSLH
RIKAKNTILATGGYGRSYFSCTSAHTCTGDGTAMVARAGLANEDMEFVQFHPTGIYGAGC
LITEGCRGEGGFLINGNGERFMERYAPSAKDLASRDVVSRSMTIEMREGRGCGPNKDYIY
LQLHHLPPNILSTRLPGISETAMIFAGVDVTREPIPVLPTVHYNMGGVPTNYKGQVVQYT
EEKGDYIVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALTIAEENKPGEPIGDL
SANSGEASVANIDKLRHANGSTPTAELRLQMQKDMQNHAAVFRDGPVLKEGCRKLDAEWK
QMDDLKVSDKSLIWNTDLVETLELQNLMINSLETIYGAEARTESRGAHSREDFKERVDEY
DYSKPLVGQTPKPLKDHWRKHTLSYVDNDTGKVRLDYRPVIDSTLDEQKVPNVPPAIRSY
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgttgaaagtgtcctctcagctggtgaagaacatcgcaatcaaaacaccg
attgcgtccacctctacagctacaagaaagctccattttggacccagtgtgaacacagat
gtgaaaacaggacagatttccaaggattatcaggtgatagatcacacctatgatgcagtt
gtcgtcggagcgggaggggcggggctcagagctgcttttggattggctaaccagggcttt
aagacagcgtgtatctccaaattgtttccaacacgatctcacacagttgcagcacagggt
ggcattaatgcagcactgggcaatatggaggaagatgattggaagtggcacatgtacgac
actgtcaagggatctgattggctgggagatcaggatgcaattcattacatgaccgaagag
gcacctaaagccgttatagagcttgagaattatggtatgccatttagtcggctggagaat
gggaagatctaccagcgcgcctttggtggtcagagtctgaaatacgggaaaggtggtcaa
gctcacaggtgttgctgtgtggctgacaggactggacactccctgctgcacactttgtat
ggaaggtccctgaaatatgacaccaactatttcatcgagtattttgctctggatcttctg
atggaggacggggagtgtcgcggggtactggcgttctgtctggaggacggaagtctgcac
agaattaaggctaagaacaccatcttagctactggaggttatggtcgctcctatttctca
tgcacctcagctcacacatgtactggtgatggcacggccatggtcgcacgtgcaggtctg
gcgaacgaagacatggagtttgtacagttccatcccactgggatctacggtgcgggctgc
ctcatcacggaggggtgcagaggcgagggagggtttctgatcaatggaaatggagagagg
ttcatggagagatatgccccctctgccaaggatttagcttctagggatgtggtgtcaagg
tccatgactattgagatgagggaaggaagaggctgtgggcctaacaaggactatatctac
ctgcagttgcaccacttgccacccaacatcctcagcactcgccttccagggatctcggag
accgccatgatcttcgctggggttgatgtgaccagggaaccaatccctgtcctccccacg
gtccattataacatgggcggcgtacccaccaattataagggacaggtggttcaatacaca
gaagagaagggagactacatcgtgccaggactgtacgcttgcggcgaggctgcatgtgca
tctgtgcacggtgccaacaggttgggcgcaaactcgctgctcgacttggtagtgtttgga
agagcatgtgctctcaccattgctgaggagaacaaacctggcgaacccattggggacctc
tctgctaattctggtgaggcatctgtggctaatattgataaacttaggcatgccaatggt
tctactccaactgctgagctaagactgcagatgcagaaggacatgcagaaccatgctgcc
gtgttccgtgatggacctgtgctgaaggagggatgcaggaaactggatgctgagtggaaa
cagatggacgacctcaaggtgtcagacaagagtctgatctggaacacagacctggtggag
accttggagctacagaatctgatgatcaactccctggagaccatctacggtgctgaggcc
aggacagaaagcaggggagcccactccagagaagactttaaggagcgtgtagatgagtat
gactacagcaaacctctagtgggacagacccccaaaccattgaaagaccactggaggaaa
catacactgtcctatgtggataatgatactggcaaagtgcgactagactacagacctgtt
attgacagtactttagatgaacagaaagtaccaaatgtcccccctgctataagatcttat
taa

DBGET integrated database retrieval system