KEGG   Lingula anatina: 106170403Help
Entry
106170403         CDS       T04921                                 

Definition
(RefSeq) cysteine sulfinic acid decarboxylase
Organism
lak  Lingula anatina
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5 DUF868 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 106170403
NCBI-ProteinID: XP_023931572
UniProt: A0A2R2MNC9
LinkDB All DBs
Position
Unknown
AA seq 545 aa AA seqDB search
MALSEKMMKYRKVDHQNGADHPFVYNSSGIQNGKHAGSRNGAVGNGMVHVTEQNGSSHNG
RHHRSKSQKFLEDVFDMMMSEAVEKGTDPKSKVLEFQQPEELATKLDIQLGHEGCEDGQL
LEMCRKTIQYSVKSGHPHFFNQLFQGFDVKGLAGAWVTEALNTSSYTYEMAPAFTLIEQE
VLMNLRKLVGYPGGEGDGIFTPGGSIANIYGVNLARFSKFPEIKSKGMQALPRICGFTSQ
QSHYSLKKAFALLGIGLDNLIPVPCDDTGRMIPSELENAIQQAKNSGAVPFFVGATAGTT
VLGAYDPLNAIADICERHQLWMHIDAAWGGGVLFSKKYRHYMEGAHRADSVTWDPHKMMG
APLQCAVFLLKHQKVLNEAHCANACYLFQQDKCYDISYDTGDKSVQCGRKVDAFKLWLMW
KERGHKGFERDIDNIFDMSRYLTQLVKDREGFELVLGEPQCTNVCFWYIPPSLRSLKRTA
EWWQKLGKVAPKIKERMMVEGTMMVGYQPLGDYVNFIRMVISNLNVTKEDMEFVVDEIER
LGKDL
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atggccttgtcagaaaagatgatgaagtataggaaagtggatcatcagaatggtgcagac
catccgtttgtttacaactcgtctggtatccaaaatggaaaacatgctgggagtcgcaat
ggggcagttgggaatgggatggtacacgtaacagaacaaaatggcagctctcataatgga
cgtcaccaccggagcaaaagtcaaaagttcttggaagatgtgtttgatatgatgatgtct
gaggctgttgagaaggggactgatccaaaaagcaaagtactggagttccagcaacctgag
gaacttgccacaaaactggacatccagctaggtcacgaaggatgtgaggatggacaattg
cttgaaatgtgtagaaaaactatccagtacagtgtcaagtcgggtcatccccactttttc
aaccagctgtttcaaggttttgacgtcaaggggcttgctggggcctgggtgacagaggca
cttaatacaagcagttacacatatgagatggcccctgccttcaccttgatagaacaggaa
gtcctgatgaacttgaggaagttggtcggctatcctgggggagagggtgatggcattttt
acaccaggagggtcaattgccaacatatatggtgtcaacctggcccgcttcagtaagttt
ccagagattaagagcaaaggaatgcaagcactaccaagaatatgtggttttacatcacaa
cagtcccattattccctgaagaaagcctttgctttgttaggaataggccttgacaatctc
atcccagttccctgtgatgacacagggaggatgatcccttctgagttagagaatgccata
caacaagccaaaaattcaggagcagttccgttttttgttggcgccacagctggcaccaca
gtactgggtgcctatgaccccctgaatgccattgcagacatatgtgagaggcaccagctc
tggatgcacatagacgctgcttggggaggcggggtcctcttctcaaagaaatacaggcat
tatatggaaggagctcacagagctgactccgttacttgggatccacacaagatgatgggg
gcacccctgcagtgtgcagtcttcctgctgaaacatcagaaagtgctaaatgaagcacac
tgtgccaatgcttgttatttgttccaacaagacaaatgttacgacatttcatacgacacg
ggagacaagtctgttcagtgtggacgtaaggtggacgccttcaagttgtggctgatgtgg
aaggagagaggtcacaagggatttgagagagatattgataacatatttgacatgtccagg
tatttgacccagctggtaaaggacagagaaggttttgagttggtgttaggggagccacag
tgtaccaatgtctgtttctggtatatccctcctagcctgaggtctttgaagagaactgct
gaatggtggcagaagctaggcaaggttgcccccaagattaaggagaggatgatggtggag
gggaccatgatggtgggatatcagcctttgggcgattacgtcaactttatacgtatggtt
atcagcaatcttaacgttaccaaggaagatatggagtttgtggtggatgaaatagaacgc
cttgggaaggacttataa

DBGET integrated database retrieval system