KEGG   Lingula anatina: 106170433Help
Entry
106170433         CDS       T04921                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase isoform X1
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
lak  Lingula anatina
Pathway
lak00010  Glycolysis / Gluconeogenesis
lak00053  Ascorbate and aldarate metabolism
lak00071  Fatty acid degradation
lak00260  Glycine, serine and threonine metabolism
lak00280  Valine, leucine and isoleucine degradation
lak00310  Lysine degradation
lak00330  Arginine and proline metabolism
lak00340  Histidine metabolism
lak00380  Tryptophan metabolism
lak00410  beta-Alanine metabolism
lak00561  Glycerolipid metabolism
lak00620  Pyruvate metabolism
lak01100  Metabolic pathways
Module
lak_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
lak_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    106170433
   00053 Ascorbate and aldarate metabolism
    106170433
   00620 Pyruvate metabolism
    106170433
  09103 Lipid metabolism
   00071 Fatty acid degradation
    106170433
   00561 Glycerolipid metabolism
    106170433
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106170433
   00280 Valine, leucine and isoleucine degradation
    106170433
   00310 Lysine degradation
    106170433
   00330 Arginine and proline metabolism
    106170433
   00340 Histidine metabolism
    106170433
   00380 Tryptophan metabolism
    106170433
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    106170433
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     106170433
    1.2.1.8  betaine-aldehyde dehydrogenase
     106170433
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     106170433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 106170433
NCBI-ProteinID: XP_013405750
UniProt: A0A1S3J5S8
LinkDB All DBs
Position
Unknown
AA seq 539 aa AA seqDB search
MAAILRTSRTVAYSLIKRTLTFKTPYRAMSSLLIDDPKYSWLKDLGLSADNKGVFHGVWT
GSGEVTTSYCPTNNQPIARVTQGSPGDYDSAVKAALEAWQTWCEVPAPQRGEIVRQIGHA
LREKKTLLGKLESLENGKILPEGEGEVQEFIDICDYAVGLSRMFQGLVLPSERPGHLLLE
QWNPLGVVGVITAFNFPVAVFGWNSSIALTCGNVALWKGAPSTPLTSIAVTRVMTSVLEA
NNMPPAVVSLVCGGADIGTLMAKDERIPLVSFTGSTPVGHIVAQMVTERFGKKILELGGN
NAIIVNEDADVDMVVRASLFACVGTAGQRCTTTRRLIVHEKLYDAVLSGLKKAYGQVKMG
DPLEPGTLLGPMHSKQGVELYLKAVADVQAQGGKIEVGGKAVDRPGNFVEPTIVTGLPHD
AEIVHRETFAPIVYIMKCKSLEEGIQWNNEVKQGLSSSLFTRDISNVFKWIGPKGSDCGL
INVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRATCTINCSRELPLAQGIKFE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggcggccattctgcgaacttcgaggaccgtagcatattctctgataaaacggacttta
accttcaagacaccttatagagccatgagtagcttgctgatagatgatcccaaatattct
tggttgaaggatttgggcttgagtgctgacaacaagggagtgtttcacggtgtttggaca
ggctctggagaggtaacgacatcgtactgccccaccaataaccagcctattgccagggta
acacaggggagcccaggagattatgacagtgcagtgaaggcagcgttggaggcatggcag
acctggtgtgaggtgccagcgccacagaggggagagattgtgcggcagattggtcatgct
ttgagagaaaagaaaactctgttaggaaaactggaatctctagagaatggcaaaatctta
ccagaaggagagggcgaggtgcaggaatttattgatatttgtgactatgcagtgggcctc
tccagaatgtttcaaggattagttcttccttcagagaggccagggcacttgcttctggag
cagtggaatcccctgggggtggtaggggtgataacagcttttaacttcccagtggcagta
tttggatggaactcctccatagctttgacctgtggaaatgtggccctttggaagggagcg
ccctctaccccactcaccagcattgctgtaaccagggtgatgacctctgtccttgaagct
aacaacatgccccctgcagtggtatctctggtgtgtgggggtgctgatattggaacactg
atggctaaagatgaaaggatccctcttgtctccttcactgggtctacaccagttggacac
attgttgcacagatggtgacagagaggtttgggaaaaagattctggaactgggaggcaac
aatgctattatagtaaacgaggatgcagatgttgacatggtcgtaagagcctctttgttt
gcctgtgtggggacagctgggcagaggtgtaccacaactaggagactgattgtccatgag
aaattgtatgatgcagttttatctggactgaagaaagcgtacgggcaggtcaaaatgggc
gatccactagaacctggcacactactgggaccaatgcattctaaacaaggagtggaatta
tatctgaaagcagtagcagatgtccaagcacagggtggaaaaatagaagttggaggcaag
gcagtggatcgaccaggaaactttgttgagcccaccatcgtgactggtttaccccatgac
gcggaaattgtacatagagagacatttgctcccattgtctacattatgaagtgcaagagt
ttagaagaaggtattcagtggaacaatgaggtaaagcaggggttatccagtagtctcttc
accagggatatcagtaatgttttcaaatggattggccctaaaggatctgactgtggcctg
atcaacgtgaacattcctaccagtggcgctgagattggaggagcatttggtggagagaag
cacactggtggaggacgagaatctggcagtgacgcctggaaacagtacatgaggagagct
acatgcacaattaactgcagcagggagttaccactggcccagggaattaagtttgaataa

DBGET integrated database retrieval system