KEGG   Lingula anatina: 106171935Help
Entry
106171935         CDS       T04921                                 

Definition
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:lak01002]
    106171935
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106171935
   04090 CD molecules [BR:lak04090]
    106171935
Enzymes [BR:lak01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     106171935
Peptidases [BR:lak01002]
 Metallo Peptidases
  Family M2
   106171935
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106171935
CD molecules [BR:lak04090]
 Proteins
  106171935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2 Peptidase_M32
Motif
Other DBs
NCBI-GeneID: 106171935
NCBI-ProteinID: XP_013407921
UniProt: A0A1S3JCL0
LinkDB All DBs
Position
Unknown
AA seq 1325 aa AA seqDB search
MSSLFRLAATVLLVVASSAKGAIAQSNTNETIARAWAEEYNQRAQIVFAESVEADWNYST
NITDYNRDVAHNASIMSAEFDREAAANASLFAWENFTDPDLRRQFRKISDVGSAALLRKD
KAKYERLISLVTKMETTYSEGQVCDKKGTCLDLEPGLTRLMATSRDYWELLDAWKGWRDA
TGRKIRNDYKEFVDLSNEAAVENGYRDTGDYWRSWYDTADFRDQLEQLYEEMKPLYLNLH
AYVKNKLKAKYGESLFPPSGHIPAHLLGNMWAQSWNNIFDIVEPFAGKPSVDVTPKMKEL
NYTPRRMFNISDEFFTSLGLKTMPQEFWDHSMLEKPTDGRRVVCHASAWDFYNQKDFRIK
QCTDVTMEELITVHHEMGHVEYYLQYKDQPVVYRRGANPGFHEAVGDVLALSVSTPTHLN
QIGLLDNVTNDTESDINYLMSIALDKIAFIPFGYLMDQWRWGVFDGSIKFEDYNKEWWKL
RCKYQGVSPPIHRNESDFDPGAKYHIPANTPYIRYFVSYVLQFQFHEALCNTANQTGPLH
MCDIYRSTEAGAKLGNMLKLGSSKPWPDALEQVTGTRNMSANAILLYFKPLIDWLKVQNQ
GQTITWSEECPIEYYTTTSAPSTTTKFKPANSTGRLHNSFFIVAFISVLTRYIVHHSDAV
GERARWDCSNTARMSSAFRLAATVLLVVASSAKGAMAQKNMNETIARAWAQEYNQRAQIV
FAEKVEAEWNYSTNITDYNRAVAHNASIISAEFDREAAENASSFAWENFTDPDLRRQFRK
ISDVGSATLLRKDKAKYERLISLVTNMETTYSEGQVCDKNDTCLDLEPGLIRLMATSRDY
WELLDAWKGWRDATGRKIRNDYREFVDLSNEAAIENGYLDTGDYWRSWYDTADFRDQLEQ
LYEEMKPLYLNLHAYVKNKLKAKYGESLFPPSGHIPAHLLGNMWAQSWNNIFDLVEPFAG
KPSVDVTPQMKKLNYTARKMFNMSEEFFTSLGLKAMPQEFWDHSMLEKPTDGRKVVCHAS
AWVFYNQKDFRIKQCTDITMDDLITVHHEMGHVQYDLQCKDQPVVYRGGANPGFQEAVGE
VLALSVSTPTHLKEIGLLDNVTNDNESDINYLMSIALDKIAYIPFGYLVDQWRWSVFDGS
TKFEDYNKEWWKLRCKYQGVSPPIHRKDDDFDPGAKYHVPANFPYIRYFVSNVLQFQFHE
ALCSTANQTGPLHMCDIYRSLEAGTKLGNMLKLGSSKPWPEALEQVTGTRNMSANAILLY
FKPLIDWLKVQNQGQNITWSEECPTEFYTTTSAPSTAKPANSTGRLHNGFFIVAFISVLA
LYILR
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctctttttcggctggcagcgacggttcttttagtggtggcttcttccgcaaag
ggcgcgattgctcagagcaatacgaacgagacgatcgccagggcgtgggctgaggaatac
aaccaaagagcgcagattgtgtttgcagaaagcgtggaagcggattggaactacagtact
aacataaccgactataacagagatgttgcacacaacgcctccatcatgtctgcagagttt
gacagagaggcggcggcaaatgcttcattgtttgcctgggagaatttcaccgatcctgat
cttaggaggcaattcagaaaaatctccgatgtcggctctgcagcactccttcgcaaggac
aaggcaaaatacgagaggctcatatcgttggtcaccaagatggagaccacttatagcgag
ggccaagtatgtgacaaaaagggcacgtgtttagatttggagccaggtcttacccgatta
atggccacctcgagagattattgggaacttcttgatgcctggaaaggatggcgggatgca
actggacgaaagattcgaaacgattacaaggaatttgttgatctcagtaacgaggccgct
gttgaaaatgggtaccgagacacaggggactactggagatcctggtacgacactgccgac
ttccgggatcaactagagcaactgtatgaggagatgaaaccgctctaccttaacctacac
gcctatgtgaagaataaactgaaggcaaaatatggagagagcttgtttccaccgagtgga
cacattccagctcacttattagggaatatgtgggcccaaagttggaacaatatattcgac
atcgtggagccttttgctgggaaacctagcgttgacgtcacccctaagatgaaggaactg
aattacacgccccgtagaatgttcaacatttctgacgaattcttcacttcgctgggtttg
aaaacaatgccgcaggagttttgggaccattccatgctagagaagcctacggatggacgt
agggttgtgtgtcacgcgtcagcctgggatttttacaaccaaaaagacttcagaatcaaa
cagtgcacagacgtcacgatggaggaactgatcacagtccaccatgaaatgggccatgtg
gagtattatctccaatacaaggatcagccagttgtgtacaggaggggggcaaatcccggg
ttccacgaggctgttggtgacgtattggctctctccgtatccacgccaacacatttgaat
cagattggactgctggacaacgttaccaatgacactgagagtgacataaactatctaatg
agcattgccctggacaaaattgcctttattccttttggatatttgatggaccaatggcgc
tggggtgtctttgatgggtcaataaagtttgaggattataacaaagagtggtggaagtta
cggtgcaaataccaaggcgtttctcccccaatacacaggaatgaaagcgattttgatcct
ggtgccaagtatcatataccagctaatacgccatatataagatattttgtgagttatgtc
ctacagttccagttccacgaggccctctgtaacacagccaatcagacaggtcccttgcac
atgtgtgacatctatcgatctacagaggcaggagcaaaacttggtaacatgttaaaactt
ggatccagtaaaccatggccagatgcactggagcaagttacagggacccgtaacatgtcc
gctaacgccatcttgctctacttcaagcctctaattgattggctaaaggtccagaatcaa
ggtcagaccataacatggtctgaagaatgtccaattgagtattacacgactacttctgct
ccttcaaccaccaccaaattcaagccagcaaattcaactggaaggttgcataatagtttc
tttatagtagcctttatatctgtattgacacgttacattgtacatcattcagacgcagtg
ggagagagagcacgttgggactgctccaacactgccagaatgtcttctgcttttcggctg
gcagcgacggttcttttagtggtggcttcttccgcaaagggcgcgatggctcagaaaaat
atgaacgagacgatcgccagggcgtgggctcaggaatacaaccaaagagcgcagattgtg
tttgcagaaaaggtggaagcggaatggaactacagtactaacataaccgactataacaga
gctgttgctcacaacgcctccatcatttctgcagagtttgacagagaggctgcggaaaat
gcttcgtcgtttgcctgggagaatttcaccgatcctgatcttaggaggcaattcagaaaa
atctccgatgtcggctcggcaacactccttcgcaaggacaaggccaagtacgagaggctc
atatcgttagtcaccaatatggagaccacttatagcgagggccaagtatgtgacaaaaat
gacacatgtttagatttggagccaggtcttatccgattaatggctacctcgagagattat
tgggaacttcttgatgcctggaaaggatggcgggatgcaactggacgaaagattcgaaat
gattacagggaatttgttgatctcagtaacgaggccgctattgaaaatgggtacctagac
actggtgactactggagatcctggtacgacactgccgacttccgagatcaactagagcaa
ctgtatgaggagatgaagccgctctatctgaacctacacgcctatgtaaagaataaactg
aaggcaaaatatggagagagcttgtttccaccgagtggacacattccagctcacttatta
gggaatatgtgggcccaaagttggaacaatatattcgacctcgtggagccttttgctggg
aaacctagcgttgacgtcacccctcagatgaagaaactgaattacacggcccgtaaaatg
ttcaacatgtctgaggaattcttcacttcgctgggtttgaaagcaatgccacaggagttt
tgggatcattccatgctagagaagcctacggatggacgtaaggttgtgtgtcacgcgtca
gcttgggttttttacaaccaaaaagacttcagaatcaaacagtgcacagacatcacgatg
gatgatctgatcacagtccaccatgagatgggacacgtgcagtatgatctccaatgtaaa
gatcagccagtcgtttacagggggggagcaaatcccgggttccaagaggctgttggtgaa
gtattggccctctcagtctccacgcccacacatttgaaagagatcggcctgctggacaac
gttaccaatgataatgagagtgacataaactatctaatgagcattgccttggacaaaatt
gcctatatcccatttggatatttggtggaccaatggcgctggagtgtctttgatggttcg
acaaagtttgaggattataacaaagagtggtggaagttacggtgcaaataccaaggcgtt
tctcccccaatacacagaaaggatgatgattttgatcctggtgccaagtatcatgttcca
gctaatttcccatatataagatattttgtgagtaatgtcctacagttccagttccacgag
gccctgtgtagcacagccaatcagacgggtcccttgcacatgtgcgacatctatcgatct
ttagaagcaggaacaaaacttggtaacatgttaaaacttggatccagtaaaccatggcca
gaggcactggagcaagttacagggacccgtaacatgtccgctaacgccatcttgctctac
ttcaagcctctaattgattggctaaaggtccagaatcaaggtcagaacataacatggtct
gaagaatgtccaactgagttttacacgactacttctgctccttcaaccgccaaaccagca
aattcaactggaaggttgcacaatggtttctttatagtagcctttatatctgtattggcg
ctttacattttaaggtga

DBGET integrated database retrieval system