KEGG   Lingula anatina: 106172255Help
Entry
106172255         CDS       T04921                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like isoform X1
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
lak  Lingula anatina
Pathway
lak00052  Galactose metabolism
lak00500  Starch and sucrose metabolism
lak01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106172255
   00500 Starch and sucrose metabolism
    106172255
Enzymes [BR:lak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     106172255
    3.2.1.20  alpha-glucosidase
     106172255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Trefoil NtCtMGAM_N DUF5110 Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 106172255
NCBI-ProteinID: XP_013408340
UniProt: A0A1S3JD46
LinkDB All DBs
Position
Unknown
AA seq 1063 aa AA seqDB search
MSGTAGFALVLFLAVFGRLSADYSCTSSVPVLQRTDCYPGSDSSKEKCQARGCTWCESSV
SGVPWCFHESVSLESATCSNSLPLDQREDCHPEAYNTYDRCTNKGCTFCQTNQNGIPWCF
YPSGSKRPGGDTCPSKIADDQRIDCFPTYLGTANKDNCVSKGCFWCSSSRPNTPWCFLDS
RDWPADNFDANERVDCFPDLIKLPTGESVTEGTLDPRQCVARGCRYRPTGTSGAPWCFFP
REKGYAVVKDEQTTKGRRLTLKRDTTLTLFAKEIADVIVDIEFQTNGRVRVKLTDANDPS
RFEVPLNITSPNAKAPNPIYDVQISTSPVFTFKVVRKDTGVAVFDTSIGGLLLEDQFLQI
ATKLPSSNVYGFGMHQHYSYKHNMNWQTWGMFTRDQPPMDGGANLYGVHPFYMGLEDNGK
AHGVLFLNSNAQDVTLSPAPALTYRTIGGVLDLYFFLGPTPENVVQQYTEAIGRPFMPPY
WSLGFSLGNYGYDNIQNMKNVVSKMKEKDIPHDYQFGDIDYMDRALDFTYSTTTYPGLPD
YVKQLKNDGTKFIIILDPAIAKDIPNYRPYDLGMKKDIWVKDSNGLWNVEGKVWPPTNVF
YPDFTKPETTDWWVTLCKEFKNVIDYDGLWIDMNEPANFVWGDVDGCASNNINNPPYFPK
IWGPVLQYKTLCPDHKHHIGLHYDVHSLYGWSQAPVTFKAAREATGKRSIVLSRSTFPGA
GKFAATWLGDNWSYWTNLRYSIIGMLEFNIFGMPFVGADICGFIRDSNYELCMRWQQVGA
FYPFSRNHNLGYENRPQDPTAWGDDFARNARDTLRTRYTLLPYLYTLFHEAHTRGDTVIR
ALFHEFPSDGATHGIDRQFLWGSSFLVSPVLDQGATSVNAYFPNARWYSYYDGAEVGTRG
DWKTLDAQIWAITLHVRGGYILPTQEPARTTMASRKNPLGLIAALDDNEQASGSLFWDDG
ESIDTYENGNYHLATFNVTSDTLTISVVHGGFPSMNQLKLNTVRVFGMKSTSISSVTQNG
NQHSDYVFNQASKELKITNLQLDASQGHTITWVKSSAMGPVIG
NT seq 3192 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggacagcaggatttgctctggtcctctttctggccgtgttcggcaggctgtcc
gcggactattcttgcacgtcatccgttcctgtactgcagcggacagattgttatccagga
agcgacagcagcaaggagaagtgtcaggcaagaggctgtacctggtgtgaaagtagtgtt
tcaggtgtaccatggtgcttccacgagagcgtctccctggagtccgccacgtgctccaac
tctttaccactagatcagcgcgaggattgccaccctgaagcctacaacacctatgacagg
tgtactaataagggatgcaccttttgccagaccaaccagaatggtattccctggtgcttt
tatcccagtggcagcaagaggccaggaggtgacacctgtccttcaaaaatagcagacgac
caacgcattgactgtttcccaacatacctgggtaccgctaacaaggacaactgcgtcagt
aaggggtgtttttggtgttctagttcgcgcccgaacaccccctggtgcttcctcgactca
cgtgactggccagccgacaactttgatgctaatgaacgcgtggactgcttcccagatctc
ataaaactaccaaccggagagtctgttacagagggaacgttggatccgcgccagtgcgtc
gctcggggatgccgctatcgtcccacggggacttccggtgccccatggtgcttcttccca
agagagaaaggatacgctgtggtaaaagatgagcagacgactaaaggtcgccgcttgacc
ttgaaacgtgacacaaccttgaccttgtttgcaaaagaaattgctgacgtcattgtagat
attgagtttcagactaatggaagggtccgggttaagcttacggacgccaacgatccatcg
agatttgaggttcccctgaacatcacctctccaaacgcgaaggcccccaacccaatatat
gacgtccagatcagcacaagtcctgtgtttaccttcaaggtcgtccggaaagatacggga
gtggctgtatttgatacttcgatcggaggtttacttctagaagaccaattcctccagata
gccaccaagttacctagtagtaacgtttatggttttggaatgcaccaacattactcctac
aagcacaatatgaactggcagacttggggaatgttcacgcgtgatcaacctccaatggac
ggcggggcaaacctttatggcgtgcaccccttctacatgggtttagaagacaacggcaag
gcacacggcgttcttttcctcaactccaatgcacaagatgtgacgctgtcccctgctcct
gctctgacatacagaacgataggtggcgtactagacctgtatttctttcttggcccaacc
ccagaaaacgtggttcagcaatatactgaggccattggtagaccgttcatgcccccctac
tggtcgctaggtttcagtctgggtaactatggttacgacaacattcaaaacatgaagaac
gtcgtgtcaaagatgaaggaaaaggacatcccgcatgattaccagttcggcgacattgac
tacatggatcgggcgctagacttcacctacagtacgaccacgtatccgggactacccgac
tacgtaaaacaactgaagaacgatggaacgaaattcatcatcattttggaccccgccata
gccaaagatattccaaactaccgtccatacgacctcggcatgaagaaagatatttgggtc
aaggattcaaatggactctggaacgtagagggaaaagtgtggccccccactaacgtattt
tacccggactttaccaagcccgagaccacggactggtgggtgacactgtgcaaggagttc
aagaatgtcatcgactatgacgggctctggatcgacatgaatgagccggccaatttcgtg
tggggagatgtagacggttgtgccagcaacaacatcaataatccaccgtacttccctaaa
atctggggccccgttctccagtataaaaccctctgtccagaccacaagcatcatattgga
ctgcactacgacgtccatagcctgtacgggtggagtcaagcacctgtcacttttaaggca
gctcgagaggcaactgggaagcgaagcatcgtcttgtctcggtcgacgttcccaggggcg
ggaaaattcgccgccacgtggttgggagacaactggagttactggacaaacctgaggtat
tctatcattggtatgctcgagttcaacatatttgggatgccatttgtcggcgctgatatc
tgtggattcatcagagacagcaattacgagttatgcatgcggtggcagcaagtgggagct
ttctatccgttctccagaaaccacaatttaggatacgaaaataggcctcaagatccgaca
gcatggggcgacgactttgcaaggaacgcccgcgacacactgcgcacgcgctacacacta
cttccgtatctgtacacgctttttcacgaggcccatacgagaggcgacactgtgatcaga
gcgcttttccacgaattcccgtcagacggagccacacatggtatagaccgccaatttttg
tgggggtcttccttcctcgtctctccagttctggaccagggcgccacaagtgtaaatgcg
tatttcccgaacgctcgttggtacagctactatgacggggccgaggtgggtaccagaggc
gactggaagactctggacgcacagatttgggcgatcacgctccatgttcgagggggttat
atcctccccactcaggagcctgctaggaccaccatggctagccgcaaaaatcctctggga
cttattgctgccctggatgataatgagcaggctagtggctccctcttttgggacgatggc
gaatcaattgatacttatgaaaatggaaactatcatcttgctacattcaatgtaacctcg
gacactttgacaatcagtgtggtccatggcggcttcccgagtatgaatcagctgaaattg
aacacggttagggtgtttggtatgaagtctacaagcatcagcagcgtcacccaaaatggc
aaccaacatagcgactacgtatttaaccaagcgtcaaaggagctgaagatcaccaaccta
cagctggacgccagtcaaggtcacaccatcacgtgggtaaaatcgtctgcaatgggacca
gtcattggatag

DBGET integrated database retrieval system