KEGG   Lingula anatina: 106172289Help
Entry
106172289         CDS       T04921                                 

Definition
(RefSeq) fatty acid synthase
  KO
K00665  fatty acid synthase, animal type [EC:2.3.1.85]
Organism
lak  Lingula anatina
Pathway
lak00061  Fatty acid biosynthesis
lak01100  Metabolic pathways
lak01212  Fatty acid metabolism
Module
lak_M00082  Fatty acid biosynthesis, initiation
lak_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    106172289
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lak01004]
    106172289
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106172289
Enzymes [BR:lak01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.85  fatty-acid synthase system
     106172289
Lipid biosynthesis proteins [BR:lak01004]
 Fatty acid synthase
  Animal type
   106172289
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   106172289
  Exosomal proteins of breast milk
   106172289
  Exosomal proteins of colorectal cancer cells
   106172289
  Exosomal proteins of bladder cancer cells
   106172289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C KAsynt_C_assoc Thioesterase PS-DH ADH_zinc_N ADH_zinc_N_2 PP-binding adh_short Methyltransf_23 Thiolase_N Methyltransf_12 Polysacc_synt_2 ACP_syn_III RNA_pol_A_CTD
Motif
Other DBs
NCBI-GeneID: 106172289
NCBI-ProteinID: XP_013408387
UniProt: A0A1S3JDA3
LinkDB All DBs
Position
Unknown
AA seq 2634 aa AA seqDB search
MLIRAYRYNFGSSMPAHIFDEPAPTGETRGAEDTLPVKMDTRNDIVISGLSCRLPESENV
QEFRDNLMNGVDMVTEDDRRWEPGLHGLPRRNGKLKDLSKFDSTFFGVNPKQANTMDPQM
RLLLEVTYEALVDAGVNPQHVRGSRTGVYIGVSSSEAGEVWSADPETLIGYSMTGCQRAM
FANRLSFYFDFKGPSFTLDTACSSSLLALDQAVIAIRTGQCDAAIVAGSNLCLKPTTALQ
FMKLGMLSPEGACKSFDVSGNGYCRSEGVVAIYLQKASAAKRIYCTVLHSKTNVDGRKKQ
GITFPSGEMQKNLLTEIYTEAKVNPSEVSYVECHGTGTKVGDPQEANTIADIFCQDRDQP
LLIGSVKSNMGHPEPASGLAALAKVIISMEDSVIPPNLHYTTPNPDIPGLSNGKLKVVTN
CTKWNGGLVGLNSFGFGGANVHAVLKSNNQKETTVHPAANEVRLFTFCGRTEEGVQHVLN
NVKQHPKDLNLQALLNQNAYGDPKMHPYRGYTLLNTTDEIQEIQNCPSEPRPVWYVFTGM
GTQWHGMGRELMQIDVFKQSIMRSHHCLKKMNISLYDLLVNGTEDTFKNTVNSFVGIAAI
QVALVDTLRSLGVKPDGIVGHSVGELGCGYADGCLTAEETVLAAYWRGKCILEADLEAGA
MAAIGLTWKEAQEQCPAGVVPACHNAEDTVTISGPKEAVATFVQELKDQGVFAKEVHSAG
VAFHSYYMAKIAPNLKEALDKVIKTPKPRSSKWISSSIPESKWTSSLAQMSSADYHVNNL
VSPVLFQEALQHVPKNAITVEIAPHCLLQSILKRSLGPKCTLTSLMKRGHSNNLEHFWAN
IGKLYMNGVNPDPLKVFPPVHFPVPSGTPMISHLVKWDHSQNFSVPTQDDFMALSGSSGK
STAFVYEVDMSPDSPDHYLVGHKIDGRVLFPATGYLVLAWRALAKMKGQLYEQMPVTFEN
VAIHRATILSKDAKVKFEICIMQSTGEFEICENGAMVASGKVYVPTDPGSQRSTEYTLED
DEEPAQEWRDLTSGDIYKELRLRGYDYGPTFQGILTTNNTGDHGQLLWNNNWVSFLDTML
QVSVLGASGRGLRLPTRITSLSVDPALHEQRVVQFDESTQAVPLSVNKYTNTCIAGGVEI
LGLHATVAPRRQQQQNPPVLEEYTFVPYKESNLLSSSNKAEYSKLLTDSSIHILKKLLEK
LEGQELPNMELLRNIVDSYEHCPADIDEMLGRYEDENCYPAAKYFKNILTSLSNGATNFR
ELLMENQELLRDPLFTSAYHPTVLKPCLDVVLENVNSSTLKVVEVGAVHGQMYKPVNQSL
GSHPLVKLDYTVTDERVQDLDQEELEMLNVQSTEWNLKSPPSDNLKSTDLIVAKGLLHQQ
EGISELLDILSSLLKDDGFLLISEPTQNFPLAFMSSYTGNEVFIAEDNHRHCGMYLSETQ
WTETFTAAGLQIIAQKSDGLMHTTFLCRKTSTVTNAVPTFLIIDNMTTFEWVEQLKKTMA
DHLDKPKEATIWLVSKNEPCNGIVGLVNCLRKEPGGDRIRCIFNASEGNLPDSCMEMESP
TFMSLRQKDLVMNVYRNGQWGSFRHMPLHQDCQIPHTEVNHAFVNVLTRGDLSSLHWIES
PLKYFDPGQNPSKKLCSVYYAALNFRDVMLATGKLPPDAIPGDLASQDCLLGMEFSGRDQ
TGRRLMGLLPAKGLATSVDADGRFLWAVPDRWTLEQAASVPVVYATVYYALVVRGQMRKG
ERVLIHSGSGGVGQAAISVALHYGCEVFTTVGSKEKKQYLMDQFPQLKDKHFANSRDTSF
EMDILRATKGKGVNLVLNSLSEEKLQSSVRVLANHGRFLEIGKFDLSNNSALGMSVFLKN
VTFHGILLDALFEEGNNDWQIVADHVTKGIQSGAVCPLKTTTFDQSNVEEAFRFMAQGKH
IGKVLIKVRDEEPETVAPPSSIKLPAICRTTCDPKLVYIITGGLGGFGLELTRWLIERGA
RHFLLTSRSGIRTGYQARCIRQWRELGLDVRISTRDISTLQDTEGLIQEALEEGPVGGVF
HLAMVLKDGLLENQSAETFQQVADSKVAGTMHLDQVTRKLCAESLKWFVVFSSVSCGRGN
AGQTNYGFANSVMERVCERRCQDKLPGLAIQWGAIGDVGIVLDNMGNNDTVIGGTIPQRI
TSCLATLDHFLNQPCPVMSSFVPADKEKSTLNKRDGGADLLDAVGNILGVKDPSTLNPDT
TLADLGLDSLMGVEIKQTLERDFDVVLSMKDVRALTINKLKAISTQGVKPVQDTSDGSPH
VSDAVADIQSTALARYNLDQLIPSDCLVRMNAVESTETPLFIVHPIEGHIQCLQSMVSYI
EYPVYGLQCTSQVSMTSIQDLAAFYIQKISEIQTTGPFRLAGYSFGACVALEMALQLQGK
AVEVQHLLLLDGSHTYVAAHTEQYRTRLMSTDNEADAESEALCAFVQQFIPVEYTQLKPH
LMSLPSLEDRVSIVTEHLMKTKLFKNEEDLKAVIVSFYQKLVIAEKYKPSDTLHGDVVLI
KAQTENGYKEKLGYDYSLNEVCNGQVIVHTAEGNHETFIQNENAEKVAQLVNDTLRAGSS
DKVVHGGAQTELESRTSGKHGDSQVPKYVNAQDLLHEEKDTDISHLHYKSLPMV
NT seq 7905 nt NT seq  +upstreamnt  +downstreamnt
atgctaataagggcctacagatataattttggaagcagtatgcctgcccatatctttgat
gagccagctccaactggtgagacacgaggggcagaggatacgctgccagtaaaaatggac
acaagaaatgacattgtcatcagtggtctctcatgtagattgccagaatctgagaatgtt
caagaatttcgtgataatctgatgaatggtgtggacatggtcacagaagatgacagacgc
tgggaaccaggtctccatggcttacccagaagaaatggtaaactaaaggacctcagcaaa
tttgacagcactttctttggtgtgaatcctaagcaggctaataccatggaccctcagatg
aggctattactggaagtcacatatgaggcacttgttgatgcaggggttaatcctcagcat
gtacgtggcagtagaactggtgtctatatcggtgttagttcttctgaagcaggggaggta
tggtctgcagatcctgagacactaattggttacagcatgactggctgccaacgcgccatg
tttgcaaaccgtctctctttctattttgattttaaaggtccaagttttacactggacact
gcctgttcgtccagtctacttgccctggaccaggcagtgatagccatcaggactggtcag
tgtgacgcagccattgtggcagggtccaacctgtgcctgaagccaactactgctctacag
ttcatgaagctagggatgctgtccccagagggcgcttgtaaatcatttgatgtgtcaggt
aatggatactgccggagtgaaggtgttgtggccatttacctccagaaagcttctgctgct
aagcgcatttattgtactgtccttcactcaaaaaccaatgtggatggaaggaaaaaacaa
ggcattacattcccatcaggggaaatgcaaaagaatctgctcactgaaatatacacagag
gctaaagtgaatccgtccgaagtgtcttatgtagaatgtcatgggacaggaaccaaagtg
ggagatccacaggaggcaaatacaatagcagatatcttttgtcaagacagagatcaacca
ttgttgattgggtctgtcaaatccaacatgggccatcctgaaccagcatctggattggca
gcgctggcaaaggtcatcatatccatggaagacagtgttattccaccaaatcttcactat
acaacccctaatccagatatcccaggactgtctaatggaaagcttaaagtcgtgacaaac
tgcacaaagtggaatgggggccttgttggactgaattcctttgggtttggaggagcaaat
gtacacgcagttctaaagtcaaataatcagaaggaaacaacagttcacccagcagccaat
gaagtaagactattcacattttgtggaagaacagaagaaggtgtgcagcatgttttaaac
aatgtgaaacagcacccaaaagatctgaatctccaggcactgctgaatcaaaatgcctat
ggtgaccccaagatgcatccatacagagggtacacactgcttaacacaactgatgagatt
caagaaatacagaactgcccatcagaaccccgtccagtatggtacgtctttacagggatg
ggcacccagtggcatggcatggggagagagctgatgcaaatagatgtgttcaaacagtcc
atcatgagatctcaccactgcctgaagaaaatgaatatcagtctgtatgacctgctggtg
aatggcacagaagacaccttcaagaacactgtcaactcttttgttggaatagcggctata
caggtggcactggtggacactctgcgttccctgggggtgaagccagatggtattgtgggt
cattctgtgggggagttgggctgtggctatgctgatggttgcctgactgcagaggagact
gtattggcagcatactggagaggaaagtgtattttggaggcagatttagaggcaggggca
atggctgctattggtttaacatggaaagaggcccaggagcagtgtccagcaggagtagtt
ccagcctgtcacaatgctgaggacactgtgaccatctctgggcccaaggaagcagtagca
acatttgttcaggagctcaaggatcaaggggtgtttgccaaggaagttcacagtgctggg
gtagcttttcactcctattacatggctaaaattgcacccaacttgaaagaagcactggac
aaggtcattaaaaccccaaaaccaagaagcagcaaatggatcagttcttccatcccagaa
tccaaatggacctcttctcttgctcagatgtcgtctgcagactaccacgtcaacaacttg
gtcagccccgtgttgttccaagaggcactgcagcatgttcctaagaatgccatcactgta
gagatagctccacactgtctgctgcagtccatactaaagaggtcccttggcccaaagtgc
actttgactagtctaatgaagagggggcattcaaacaatcttgaacatttctgggccaac
attggaaagctctacatgaatggagtgaatccagaccccttgaaggttttcccaccagtc
cattttccagttcccagtggcacccctatgatatctcacctggtgaagtgggaccattcc
caaaatttttctgttccgacccaggatgacttcatggccttgtctgggagcagtgggaaa
agtacggcctttgtgtatgaggtggacatgtccccggattctcctgatcattatttggtc
ggccacaagatagatggaagggttctttttccagcaacaggataccttgtcctagcttgg
cgggctctagcaaagatgaagggacaactatatgaacagatgccagtgacttttgaaaat
gttgccatacatagagctacaattttatcaaaagatgccaaggtgaaatttgaaatctgt
ataatgcagtctacaggagaatttgagatttgtgaaaatggggctatggttgcgagtgga
aaggtgtatgttccaacagatccgggctcacagagatctacagaatacacgttggaagat
gatgaagagccagcacaggaatggagagatctgacgtctggagacatctataaagagttg
aggctcaggggatatgattatggtccaacatttcagggcattctgaccacaaacaataca
ggtgatcatggccagttactctggaacaacaactgggtttctttcctggacaccatgtta
caagtttctgtacttggcgcttctggacgtgggctgcgtctgccaactaggatcacttcc
ctttcagtagatcctgcattacatgaacagagagttgtacaatttgatgaaagtactcaa
gctgtgccacttagtgttaacaaatacactaacacatgtattgctggtggtgttgaaatc
cttggcctacatgcaacagtggcacccaggagacaacaacaacaaaatccacccgtcctt
gaggaatacacattcgtcccatacaaagaatcaaatctgctcagttcttcaaataaagct
gaatattcaaaacttctcacagattcttccatccatattttgaagaaattgcttgagaaa
ctagaaggtcaagagttgccaaacatggagctactaagaaacattgtggattcttatgaa
cattgtcctgcagatattgacgaaatgctggggcgctatgaagatgaaaattgttatcca
gctgcaaaatacttcaagaatattctcacatccttgagcaatggtgccacaaatttccga
gaacttttaatggagaatcaagaactcttgagagatcctctctttacttctgcataccat
ccgacagttttgaaaccatgcttagatgtggttttagaaaatgtcaacagttctacattg
aaggtagtggaggttggggcagtccatgggcagatgtacaaaccagttaatcagtctcta
gggtcacatcctctggtcaaattggattatacagtgactgatgagagagtccaagatttg
gaccaggaagaattagagatgttaaatgttcaaagcactgaatggaatttgaaatctcca
ccctcagacaaccttaaatctacagatttgattgtagcaaaaggtttactgcatcagcag
gaagggatttcagaactgttagacatactttctagtttactgaaagatgatggcttcttg
ttgataagtgagcctacacaaaactttcccctagcattcatgtcatcatacacaggaaat
gaggtcttcatagcagaggacaatcacaggcattgtgggatgtacttaagtgaaacgcag
tggacagaaacatttacagcagcaggtttgcagataattgcccaaaagagtgatggactt
atgcacacaactttcttatgtaggaaaacatctacagtgaccaatgctgtgccaaccttt
ctcatcattgacaacatgaccacatttgagtgggtagagcagctaaagaaaaccatggct
gaccacttggacaagccgaaagaggccactatctggttggtgtccaaaaatgagccttgc
aatggaatagtgggactagtgaattgtctcagaaaagagcctggaggtgatagaattagg
tgtattttcaatgccagtgaaggtaacttacctgattcttgtatggaaatggaaagtcca
acttttatgtctctaagacaaaaggaccttgtgatgaatgtgtacagaaacggccaatgg
gggtcctttagacatatgccactgcatcaggactgtcaaattcctcacactgaagtcaac
catgcttttgtgaatgtgctgactaggggtgacctgtccagtttacactggatcgagtct
cccctaaagtactttgaccctggccagaaccccagtaaaaaactgtgtagtgtgtactac
gctgctctcaacttcagagatgtcatgctggccactgggaagctgcctcctgatgccata
ccaggtgatctggcatctcaagactgtctgctgggtatggagttttctggaagagaccag
acaggaagaagacttatgggtctgctacctgcaaagggccttgctacctcagtggatgct
gatggtaggttcctatgggcagttccagatagatggacactggagcaggctgcctctgtc
ccagtggtctatgctacagtctactatgccttggtggtcaggggacagatgaggaaagga
gagagggtgctgatccattctggcagtggaggtgttggtcaggcagctatatcagtggct
cttcactatggttgtgaagtatttacaactgttggttctaaggagaaaaaacagtacctc
atggaccagtttcctcagctgaaagacaagcattttgccaactcacgggatacatcattc
gaaatggatattttgagagcaaccaaggggaaaggtgtgaacttggtgctgaattccctg
tctgaagagaagttgcaatctagcgtcagagttttggcaaaccatggaagatttctggag
attggaaagtttgatctttcaaacaattctgctctgggtatgtcagtgtttttgaagaat
gtcacattccatgggatattattagatgcattgtttgaggaaggaaacaatgactggcag
attgtagcagatcatgtgactaaaggtatccaatcaggagcagtgtgtccactgaagaca
accacctttgaccaatcaaatgtggaagaagctttcaggttcatggctcaaggaaagcac
ataggaaaagtacttattaaggtcagagatgaagaaccggagacagtagcacctccatcc
tcaatcaaacttcctgccatatgcagaactacctgtgaccccaagctggtctacatcatc
acaggaggcctgggagggtttggtctggagttgacacggtggctgattgaacgtggggct
agacatttccttctcacgtctcgctcaggaatcaggactggttatcaggctcggtgtatc
aggcagtggagagaactgggacttgatgtgaggatttcaaccagagatatttccaccctg
caggacactgagggactcattcaggaggccttggaagaaggaccagttggtggagtcttt
caccttgccatggtattgaaagatggattactggaaaatcaaagtgcagaaacatttcaa
caagttgctgactctaaagtggctggcacaatgcatttggaccaagttactcgcaaactt
tgtgctgagagtttaaaatggtttgtggtgttttcttctgtaagttgtggccgaggaaat
gctggccaaactaattatggttttgccaactctgtcatggaaagggtgtgtgagaggaga
tgccaggacaaactaccaggcctggcaatacagtggggtgcaataggtgatgttggcatt
gttttggataacatgggcaacaatgacactgtgattggtggtaccataccacaaaggatt
acatcatgtctggccactcttgaccacttccttaatcagccgtgtccagttatgtccagt
tttgtgcctgctgacaaagaaaaatccacattgaataaaagagatggtggtgctgatttg
ctggatgctgtgggaaacatcttgggtgtgaaagaccccagtacacttaacccagatacc
accctcgcagatctgggcctagactccctgatgggtgttgagatcaagcaaactctagag
agagattttgatgtggttctgtccatgaaagatgtgagagctctgacaatcaacaaactg
aaagcaatctcaactcagggggtcaaaccagttcaggacacgagtgacggttctccacat
gtttctgatgctgttgcagacattcaaagcacagcgctggctagatacaatctggaccag
ctcattcctagtgactgtcttgttaggatgaatgcagtagaaagcacagaaactccattg
tttatcgtccatcctattgaaggtcacatccagtgtttgcagtccatggtctcctacata
gagtatcctgtgtatgggcttcagtgcaccagtcaggtgtctatgacttccatacaggac
ctggcagctttctacatacagaaaataagtgaaatccaaaccacaggaccattcaggtta
gctggatactcatttggggcctgtgttgctctagaaatggcacttcagcttcagggcaag
gctgtcgaggtgcagcaccttctgttgcttgatggctcccacacctatgttgctgcccac
acagagcagtacagaacaagactgatgtccactgataatgaagctgatgcagagagcgag
gcactgtgtgcctttgtacaacagtttattcctgttgagtacacacagcttaagcctcat
ttgatgtctttgccatcgttggaagacagagtatcaatagtaacagaacacctgatgaaa
accaagctgttcaagaatgaggaggatctgaaagctgtgatcgtctcattttaccagaag
ctggtcatagcagagaagtacaagccttcagacactctccacggagatgttgtgctgatc
aaggcacagacagaaaatggttacaaagaaaagttgggatacgattacagtctaaatgag
gtctgtaatggacaggttattgttcacacggcagaagggaatcatgaaactttcattcag
aatgaaaatgctgaaaaggtggctcagcttgtaaatgatacacttagggcaggatcatca
gacaaggtagttcatggaggggctcaaacagaactagagagcaggacttcaggcaaacat
ggtgattcacaggtccctaaatatgtaaatgctcaagacttactgcatgaagaaaaagac
acggacatttcacatttgcactataaatcacttcccatggtgtag

DBGET integrated database retrieval system