KEGG   Lingula anatina: 106172630Help
Entry
106172630         CDS       T04921                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: histone deacetylase 6-like
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
lak  Lingula anatina
Brite
Enzymes [BR:lak01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     106172630
Protein phosphatases and associated proteins [BR:lak01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     106172630
Messenger RNA biogenesis [BR:lak03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     106172630
Membrane trafficking [BR:lak04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    106172630
Chromosome and associated proteins [BR:lak03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     106172630
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 106172630
NCBI-ProteinID: XP_013408875
UniProt: A0A1S3JEN4
LinkDB All DBs
Position
Unknown
AA seq 1153 aa AA seqDB search
MDPPIINKGSPASEPDSASSDPKATGLVQTENPSPNSCEGGVGDAPAPAPQTKSDETPSN
VKTQSVKPKKSASTGKKKGKQSKGPTLEELKRRGRDTRQHPHQDNIQIMDKMADLSMKSM
KLTNLGTGLIYDHFMTQHRCEWDLLHPECPDRITEPYLRCLQYGLVTRCVPILPKKSVDE
AALSQHSPEYLKLLKDSQFLSEIQPLQDLSEKYHGIYFNSPKMTSEKGHLPEHFLPRGVQ
TLQDLSGKYDSIYFNSKTFECAQLSLGSTIEMTEQILQEKVRNGFAIVRPPGHHAMYKEA
CGYCFFNNVAIAAKRALDKFGLERVLIVDWDVHHGQGTQYMFYDDPRVMYVSIHRYEYGN
FWPNLRESDYDYIGEGRGTGYNINIPLNKTGMTNSDYMAVFHQLLMPIFYEYNPQLVLVS
SGYDAAIGCPEGEMEVTPACYAHFINMLSALADGKLAVILEGGYCLKSLSEGVALTLRAL
LGDPTPRIGPLQQPNDVIKKTILNAIRVLRPYWQCLQFQGVLPVQSAEVSSTTQEDEHLR
TVPFSTPENRPEVYPIDECCYPVQEPEVKATYSARIQELIDNTYLGKAPHRTALVYDEVM
RKHKNHVDPGHPERPDRITKIYNKIQEYRLLKHCLRVESRMATDEEVLTCHKTEHFKKMQ
QIKETKPRELKEVQLQYNSVYLCQESYDCALLAVGSLLNVVEAVLTNKSQNGVAVIRPPG
HHAEINQACGFCLFNNVAIAARYAQKTFGVKKVLILDWDVHHGNGIQHIFEDDPSVLYIS
IHRYDQGFFFPAGPDGNYDKVGNGAGAGFNINIPWNKYGMGDAEYIAAFLQVIMPVAYEF
DPDLVLVSAGFDAARGDPLGHCDITPAGYGHMTQMLMSLANGRVILALEGGYNLHSISES
MAMCTKVLLGGTCPPLGSLVPKTMAVESICNVLDTHKKYWKCLQFRVDLPAPVLPVTAGV
QNNAVTSTSDMDSLTTAIGALQVKYESVSSSSDGGSFLSSPTVTSSDCTGDSPLGACGGS
EAKNLTVRELLGGALADQDDLQMFAVVPLPWCEHLKMVAPPPERGLDVFAACSMCESTKE
NWVCLTCYEVCCGRYVNEHMLFHGLSTEHKMVLSYSDLSVWCYGCDAYIHNEIIVPHKRA
AHRSKFGEDIPGV
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccgatcataaacaaaggatctccagcatcagagccagattcagcgagctct
gatcccaaggccacaggactagtgcagactgaaaatccatcaccaaattcctgcgagggg
ggtgtaggggatgccccagcccctgcaccacagacaaagagtgatgagaccccatccaat
gttaagacacagtcagttaaaccaaagaaatcggctagtacgggtaagaagaaaggcaag
cagtccaagggacccacactggaagaactgaagagaagaggacgagacacccgccagcac
ccccaccaagataatatacagatcatggacaagatggctgacctgtccatgaaatcaatg
aaattaacaaatctgggtacggggttgatctatgatcacttcatgacccagcacaggtgt
gagtgggacctcctgcaccctgaatgtcctgacaggataacagagccttatttaagatgt
cttcagtatggtctggtcaccagatgtgtacccatattgcccaaaaagtctgttgatgaa
gctgctctaagtcagcatagtccagaatacctgaagcttttgaaggactctcagttcctt
agtgagatccagcctcttcaagacctgtcagaaaaatatcatggcatttattttaacagt
cctaaaatgacttcagagaaagggcatctccctgaacacttcttaccaaggggggtccag
acactccaagacctctcagggaaatatgactccatttacttcaacagcaaaacatttgaa
tgtgcacagctttctctaggcagtaccatagaaatgacagaacagatcttgcaagaaaag
gttagaaatgggtttgccattgtaagacccccaggtcaccatgcaatgtacaaagaggcc
tgtggatactgcttctttaacaatgtggccattgctgcaaaacgcgctctggacaagttt
ggtctggaaagggtgttgatagtggactgggacgtccaccatggtcaaggcacacagtac
atgttctatgatgacccaagagtgatgtatgtgtctatccaccgttatgagtatggcaat
ttctggccaaaccttcgagagtccgactacgactatataggagagggtcgaggtacaggc
tacaacatcaacatacctctcaataagactggtatgactaacagtgactacatggctgtg
tttcatcaactactcatgcctatattctatgagtacaaccctcagctggtattggtctcc
tctggttatgatgcagctataggatgcccagagggggaaatggaggtgaccccagcttgc
tatgctcattttatcaacatgctcagtgctctggctgatggcaaactggctgttatacta
gagggaggatactgcctgaagtctctgtctgagggcgtggctctcacactgagggctcta
ctgggagacccgacacccaggataggaccactacagcaacctaatgatgttatcaagaag
accatactgaatgctatccgcgtgttacgtccatattggcagtgtctccagttccagggg
gtgctgccagtacagagtgctgaggtatccagtaccacacaggaagatgaacacttgaga
actgtgccgttttccaccccagagaaccgtcccgaggtgtacccaatagacgagtgttgt
tacccagtccaggagccagaggtaaaggccacctacagtgccagaatacaggagctgata
gataacacttacctgggcaaggcaccacacaggacagccctggtctatgatgaagtcatg
aggaaacacaagaaccacgttgatccgggtcacccagagagacctgacagaataaccaaa
atttataacaagattcaggagtataggttgctgaaacattgcctaagggtggagtcaagg
atggcaacagatgaagaggtactgacatgtcacaagacagaacactttaagaagatgcag
cagattaaagagaccaaacccagagaactcaaagaagttcagctgcagtataactcagtc
tatctatgtcaggagtcctatgactgtgccctgctggctgtaggtagtctgttaaatgtg
gtggaggcagtcttgactaacaagagtcagaatggtgttgctgtgataagacccccaggt
caccatgcggagatcaaccaggcgtgcggattctgtctgtttaacaatgttgccatcgca
gctcgctatgctcagaagacgtttggtgtgaaaaaagttctaatactggactgggatgtc
caccatggtaatggtatacagcacatctttgaagatgatccaagcgtactgtacatatca
atccatcgctatgaccaggggttcttcttccccgctggaccagatggaaactatgataaa
gtgggaaatggagcaggcgctggctttaacatcaacattccctggaacaagtatggtatg
ggtgacgcggagtacatagcagccttcctccaggtgatcatgccagtggcatatgagttt
gacccagatttggtgttggtatccgctgggtttgatgcagcaaggggagatcccttgggt
cattgtgacatcacccctgctggctatggtcacatgactcagatgttgatgagcttggcc
aatgggagagtcatattagcactagagggtggctacaacctccactccatatcagaaagc
atggctatgtgtaccaaggttctcctgggaggaacatgtccgcccctggggtctctggta
cctaagacaatggccgtagagtccatatgtaatgtgctggacacacacaagaagtactgg
aagtgtcttcagtttagggttgatttaccagccccagttctcccagtgacagcaggtgtc
cagaacaatgctgtgaccagtacctcagatatggacagtcttaccaccgccattggagct
ctacaagtgaaatatgagtcagtcagcagctcttcagatggaggcagttttctgtcctcg
cctacagtgacatctagtgactgcacgggagactctcctctaggagcttgtggtggatca
gaggccaagaatttgactgtacgcgagctactgggaggagccttagctgaccaggatgac
ctgcagatgtttgctgtagttcccttgccatggtgcgaacatctcaaaatggtggctcct
ccaccagagagaggcctggacgtgttcgcagcatgctccatgtgtgaaagcacgaaggaa
aactgggtctgcctcacatgttatgaagtttgctgtggaagatacgtcaatgagcacatg
cttttccatgggttgagtacagaacacaaaatggtattaagctattcagacctgtcagtg
tggtgttatggatgtgacgcctacatacataatgagattatagtgccacacaagagagca
gcacacagaagcaagtttggagaggacattcctggagtgtga

DBGET integrated database retrieval system