KEGG   Lingula anatina: 106174580Help
Entry
106174580         CDS       T04921                                 

Definition
(RefSeq) lysosomal alpha-glucosidase isoform X1
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lak  Lingula anatina
Pathway
lak00052  Galactose metabolism
lak00500  Starch and sucrose metabolism
lak01100  Metabolic pathways
lak04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    106174580
   00500 Starch and sucrose metabolism
    106174580
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    106174580
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lak04147]
    106174580
Enzymes [BR:lak01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     106174580
Exosome [BR:lak04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   106174580
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 106174580
NCBI-ProteinID: XP_013411655
UniProt: A0A1S3JMP0
LinkDB All DBs
Position
Unknown
AA seq 946 aa AA seqDB search
MTKDTETLIRLPKRKQSSHDCLIKNSGCLWLSLTSVFTIVLIACFTLLWVYISSGPSRDP
GSIVQRLFFRVKAAGTNVKQECAITDERKFDCHPEVGATKSICASRGCCWKPTTPSASNL
NSVSSVGVPSCFYPLNYTEYHVGNISRTSDKITAFLSRNTSSYYKEDVKLLKLVVTYESS
YRIHIKIYDPLHPRYEVPVEINKPAKIFGSSSAASSFDIKITESPFSFQVYRKDGHVKLL
DTSVGGFIFADQFLQLSTLLPSRYVYGLGEHRATLLHSLNWTRVTLWNKDRPPVEHSNLY
GSHPFYLVMEEDGRSHGVFLLNSNAMDVILQHAPAITWRAIGGILDFYIFTGPSPANVIS
QYTELIGRPFMPPYWSLGFHICRYGYKSVNQTLDVALRTHAAGIPQDVQWDDLDYSYGWM
DFTYDAERFGDVPGLARTLHDMGMHYMMIFDPGLSNSQPIGSYLPYDYGMELDLFIKDNV
TGKPLVGKVWPGTTVWVDWTHPKAQKYWTTLVTGFHNQVEFDGMWVDMNEPSNMVNGAVD
GCPKNSSLENPPYVPAVHGGSLKFFTICPSSTQYTSSHYNLHNLYGLMMTKMSHNALLNA
RPNQRPFVISRSTYPGQGRYGGHWTGDNAATWHDLYASIPGILNFNLFGIPMVGADICGF
RMNTTEPLCQRWYQLGAFYTFSRSHQERDTNSHDPTMFSKTLIDSTRKAYLLRYSLLPHL
YTLFYNSHTRGETVLRPLFFEYPKDKNTYGIDQQFMWGKCFLISPVLSENTTEVQGYFPK
GSWYDIQTGSQQKSNGQYVTIATPLDKINVHLREGCVIVTQTPNLTTTMSRKNKFGLVVA
LLDDGKSEGELYADDGKSADSIQKSKYNRILFSASKKDRQITSAVDHLGYHEDMVLGNLT
IFNIGTKPSQLTVNGVLCNFTFSQNQVINVEGLTADLKKRLTVKWT
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagacacagaaacgctaatacggctaccaaaaagaaagcagagctcgcatgac
tgtctgatcaaaaattctggctgtttgtggctgtcactgacatcagtgtttacgatagta
ctgatagcatgcttcacgttgctgtgggtatatatttcctcaggcccttctcgagatcct
gggtccattgttcagcgtttattcttccgagtcaaagcggctggaacaaacgtaaaacaa
gaatgtgcaattacggatgagagaaaatttgactgccacccagaagtcggtgctacgaaa
tccatttgtgcttctcgtggctgttgctggaaaccaaccaccccgtctgcttcaaactta
aattcagtgtcttccgttggcgtgccatcttgcttttatcccctgaactacacagaatat
cacgttggtaatatttcacggacctcagataaaatcactgcttttttgtcaagaaacacc
agttcatattacaaagaagatgtaaaacttctgaaactggttgtaacatatgagtcaagt
tatagaatccatataaaaatatatgatcctttgcacccaagatatgaagttccagttgaa
ataaacaagccagcaaagatattcggttcttcttcagctgcttcatcctttgacataaag
ataacagagtctcccttcagctttcaagtgtacaggaaggatggacatgtcaaactttta
gacaccagtgttggtggcttcatctttgctgaccagtttctacagttgtccacactgctg
cccagcaggtatgtctatggattgggtgagcacagggccacactgctgcactcactgaac
tggaccagggtcactctatggaataaggacaggccaccagtggagcacagcaacctttat
gggtcacaccctttctatctggtgatggaggaggatggtagaagtcatggagtctttttg
ctgaacagcaatgctatggatgttattcttcagcatgcgccagctattacctggagggcc
attggtggtatcctagacttctatatcttcacaggtccaagtccagccaatgtcatttct
caatacacagagctcattggccgcccatttatgccaccatattggagtttagggtttcat
atctgtcgctatggttacaagtcagtcaatcagaccctggatgttgctctacgaactcat
gctgctggaatccctcaggatgtccagtgggatgatcttgactacagctatggctggatg
gacttcacttatgatgccgagaggtttggagatgtgccaggactggcaaggacactgcat
gacatgggcatgcactacatgatgatctttgatcctggcctaagtaattctcagcccatt
ggatcttatttgccatatgactatggtatggaattagacctctttatcaaggataatgtc
acaggaaaaccacttgttgggaaggtgtggccaggtactacagtgtgggtggactggacc
catcccaaggctcagaagtactggaccaccttggtgactggcttccacaatcaggtggaa
tttgacgggatgtgggtggacatgaatgaaccttccaacatggtcaatggggcagtggat
ggttgccccaaaaattcttctctggaaaacccaccatatgtcccagcagttcatggagga
agtctgaaatttttcaccatctgcccgtcatccactcagtacacctcctcacactacaac
ctgcacaacttgtatgggctgatgatgaccaaaatgtcccacaatgctttgttgaatgct
cgaccaaaccaacgtccatttgtcatctcaagatccacgtatccaggtcaaggcaggtat
ggaggccactggactggagacaatgctgccacctggcatgacttgtatgcctccattcca
ggcatcctgaacttcaatttgtttggaattcctatggttggagctgacatctgtgggttc
agaatgaacaccacagagccattgtgtcagaggtggtaccagcttggtgccttctacacc
ttttcacgctcacatcaggaaagagatacaaatagtcatgatcctaccatgttcagtaaa
acgttgatagactctaccaggaaagcctacttgctgaggtatagcttgttaccacacctt
tacacactgttctataacagtcacaccagaggagaaacagtactcaggcctttattcttt
gaatatccaaaagataaaaatacatacggtattgaccaacagtttatgtggggaaaatgt
tttctgatatcacctgtgctttctgagaacactacagaagtccaggggtattttccaaaa
ggtagctggtacgacattcagacggggagtcaacagaaatccaatggacaatatgttacc
atagcaactccattagataagataaatgttcacttgagagagggctgtgtcatagtgaca
caaacacccaatctcactacaacaatgagtcggaaaaacaagtttggtctggtggtagca
ttgttggatgatgggaaaagcgagggagagttgtatgcagatgatggaaagtcagcagac
tctatccagaagtcaaaatataatagaatcttattttcagccagtaaaaaggacagacag
attacctcggcggtggaccacctggggtatcatgaagacatggtgctggggaacctcact
atatttaacataggaaccaagccaagtcagttaacagtcaatggagtgctgtgtaatttt
accttctcacaaaatcaggtgataaatgtggagggattgactgcagatttgaagaaaaga
ctgacagtcaagtggacatga

DBGET integrated database retrieval system