KEGG   Lingula anatina: 106174755
Entry
106174755         CDS       T04921                                 

Definition
(RefSeq) uncharacterized protein LOC106174755 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
lak  Lingula anatina
SSDB
Motif
Pfam: RA Nore1-SARAH Ras_bdg_2
Other DBs
NCBI-GeneID: 106174755
NCBI-ProteinID: XP_013411884
UniProt: A0A1S3JPF7
LinkDB
Position
Unknown
AA seq 592 aa
MAQNPQPKKRIIMRIRSQGSRELPPQPPGSPSGGSPKMGAKNLQQKFAKVNFGTKNPKLS
DFEKCFNEFTDEFKHYHGSTDEESEEHKGKRPPLQRSDHDTDSKGQGHPEDQSFGEGEPC
GKKFQDIFSPFDAECDPFGMQHEFDKKSRPHLRRTRSRDKSKSAFSDSFFSSPKMEDIFG
ESSSSSRRKKKPSFFEEFETMSSAIMEEFFSDKPPGERWKTCAEKFGDLNLDSDDSDDDK
FFSHSSFLGKRDKKDKKQSKSCPSCGQKKRSKQTPATCDHCDSACDDNCNYTCHHRCRPL
VSIDCPHENTNNHRPRGNAETSLSEILQVTPGKVVRVRQQSDDVDSGYSTGSPHSSMYNS
LTQEELRTKVETFNLSNPGLAMTMPDDSDTFQGFIRVNMNLTRPISMSLGTRPPSIYEVL
TNEAQGDTLDRNTITSFYLPRDTVKALFVNSATTVRQVIDVLLRKFKITDNPRKFALYEQ
SYNDENKENPVKLRKLTDNEHPLMVCLDWPSARMEHRKFVLQENDMQEILWEEFSLPELQ
NFLKILDKEEQEYIQDIKYKFKVRKIHMQELLTEKNPNQEKGEKKGSKNKAE
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggctcagaatcctcaacctaaaaagaggatcatcatgaggataaggtcccaggggtcc
cgggagttaccccctcagcctccagggtctcccagtggggggagccccaagatgggggcc
aagaacttacagcagaagtttgccaaagtgaattttgggacaaagaaccccaaactgtca
gactttgagaagtgtttcaatgaatttacggatgaattcaaacactatcatggctccaca
gatgaggagagtgaagagcataaaggcaaacgtccgccattgcagagaagtgaccatgac
acagattccaaaggtcaaggtcatcctgaagatcagagctttggtgaaggtgaaccctgc
ggtaagaagtttcaagatattttctctccgtttgatgctgagtgtgatccctttggcatg
cagcatgagtttgataaaaaatctagaccacacctgagacgtactcgctccagggacaaa
agtaagtctgcctttagtgacagtttcttttcctcccccaaaatggaggacatttttgga
gaaagttcctcttcttcacgtagaaaaaagaaaccaagtttctttgaggaatttgaaact
atgagcagtgccattatggaggagtttttcagtgataaacctccgggagaaagatggaag
acttgtgctgaaaaatttggagatttaaatctcgattcagatgattcagacgatgacaag
tttttctcgcacagttcattcttaggcaagcgtgataaaaaagataagaagcaatcaaag
tcttgtccatcttgcggtcagaagaaacggtcaaagcagactccagccacctgtgatcat
tgtgattctgcctgtgatgataattgtaactacacatgtcaccaccggtgtcgccctcta
gtgtcaatagactgtccacacgagaacacgaacaaccaccggccgcgcgggaatgcggaa
acctcgctgtcagaaatacttcaggttactccagggaaggtagtcagggttcgccagcaa
agtgacgatgttgactctggatattctacgggcagtccccactcctccatgtataactct
ctcacacaggaggaactccgcaccaaggtggagacattcaacctgagcaaccctggcctg
gccatgaccatgcctgatgacagtgacacattccaaggtttcattcgagtcaacatgaac
ttgacgcgtccaatcagcatgtccctgggcacaagaccgccatctatctacgaggttctg
accaatgaggcgcagggagacacgttggacaggaatacaattacgtcattttatctccct
agggatacagtgaaagctttatttgtaaacagtgccaccacagttcgacaagtcatagat
gttcttttaaggaagttcaaaatcacagataaccccaggaagtttgccctttatgagcag
agttacaatgatgagaataaggaaaaccctgtgaaactaagaaaacttacagacaacgag
caccccctgatggtgtgtctcgactggccatctgctcgcatggagcaccgcaagtttgtg
cttcaagagaacgacatgcaggagatactttgggaagaattcagcctaccagaacttcag
aattttctcaaaattctcgacaaggaggaacaggaatatatccaagacattaagtacaaa
tttaaagtacggaaaattcacatgcaagagcttttaacagaaaagaaccccaaccaggaa
aagggagaaaagaaaggatctaaaaacaaagctgaatag

DBGET integrated database retrieval system