KEGG   Lingula anatina: 106176891Help
Entry
106176891         CDS       T04921                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lak  Lingula anatina
Pathway
lak03030  DNA replication
lak03410  Base excision repair
lak03420  Nucleotide excision repair
lak03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lak00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    106176891
   03410 Base excision repair
    106176891
   03420 Nucleotide excision repair
    106176891
   03430 Mismatch repair
    106176891
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lak03032]
    106176891
   03400 DNA repair and recombination proteins [BR:lak03400]
    106176891
Enzymes [BR:lak01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     106176891
    6.5.1.6  DNA ligase (ATP or NAD+)
     106176891
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     106176891
DNA replication proteins [BR:lak03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    106176891
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     106176891
DNA repair and recombination proteins [BR:lak03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     106176891
   NER (nucleotide excision repair)
    Other NER factors
     106176891
   MMR (mismatch exicision repair)
    Other MMR factors
     106176891
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 106176891
NCBI-ProteinID: XP_013414920
UniProt: A0A1S3JWW3
LinkDB All DBs
Position
Unknown
AA seq 997 aa AA seqDB search
MQKSITSFFSPGRPKAKDENAGVPSQKPKPKEGNVNSTTKSHKPQSPLKQKNHSPSKDQD
SPLKSRAKNKKGRRIIESDDEEEEEKDIPMEVPERKDEENPKEEKEKKEEIKNDVEDKYD
KVEVVGSPPKPLSQASSSSSSPAVASPHGIPMRKTARKHMKKRKLEEDKPLESDSGNKKS
KLDQETANDTNNVEKNDKAESKSATPEGKAKVSKKPPYEDQDVEMEEQVKEKSPPNKKKG
PKSKKSPQEKKDKGKKVKEEKKEDSGNDKERNVVSEEKEVEKKVVKQELHSFFAPKTNSK
KEPTQEKKIEENTKSTDKTPDKPAAKSGFAGFGDKSAGDGSNYDPSKPNYHPINDAFWKK
GEKVPYLACAKTFQAIESITARLKIVEILANFFRSVIVLSPDDLLPCLYLCLNKLAPAYE
GVELGIGETVLMKAIAQATGRGVDKVKADAQEKGDLGIVAEASRSNQRTMFAPAKLMAST
VFTRLKEIATMSGNSVMSKKIDKIKGMFVACRFSEARYLIRSLGGKLRIGLAEQSVLVAL
AHAVVLTPPGQEYPPEILDASNGISAEKFKKKMDDAALIIKTTYCECPTYDKIIPVLLKE
GLEELPKHCKLTPGIPLKPMLAHPTKGVSEVFRRFEEAAFTCEYKYDGERAQIHVREGGE
INIYSRNSEDNTSKYPDIIGRMKSCMLPSVQTCILDSEAVAWDQEKKSILPFQVLSTRKR
KDADASEIKVQVCVYAFDLLYLNGESLVKEPFSRRRELLHQSFKEVEGEFMFATHLDSKD
TDQIGEFLEESIKGNCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLEGVGDTLDLVVIG
GYHGTGKRAGKYGGFLLACYDEENEEYQTICKIGTGFKDDDLDQHNASLKQHVIDKPRSY
YRCDSSLDPDHWFDAVQVWEVKAADLSISPVHSAAAGLVDPEKGISLRFPRFLRIRDDKK
PEEATSSNQVSELYRNQQQIKNQNTEGKTEEGEEDFY
NT seq 2994 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatccatcacatcgttcttctcacctgggaggccaaaagcgaaggatgaaaat
gcgggtgttccttctcagaagccaaagcctaaggaagggaatgttaacagcactactaag
agtcacaaaccacaatcacccctaaaacaaaaaaatcatagcccttccaaagaccaggat
tcgcccctgaaaagtcgggccaagaacaagaaaggaagaagaattattgagagtgatgat
gaggaagaggaagagaaggatattccaatggaagttccagaaagaaaagatgaagaaaat
cccaaggaagaaaaagaaaagaaggaagagataaaaaatgatgtagaggacaaatatgac
aaagtggaggtcgtaggttccccacccaaacctctgagccaagcgtcttccagctcttcc
agtcctgctgtggcatctccacatggtataccaatgaggaaaacagcaagaaaacatatg
aagaagcgtaaacttgaagaagacaaaccactagaatctgactctggcaacaagaagtct
aaactggaccaagaaacagcaaatgacactaataatgtggagaaaaatgacaaagctgag
agtaaatctgccaccccagaaggaaaagccaaagtctctaagaaacccccttatgaagac
caggatgtggaaatggaggagcaagtgaaagagaagtctccacctaataaaaagaaaggg
ccaaaatctaaaaaatcacctcaagagaagaaagataaaggaaagaaagtaaaggaagaa
aagaaagaagattcaggaaatgacaaggagagaaatgttgtatcagaagaaaaagaagta
gaaaagaaggtagtaaagcaagagttacacagtttctttgcaccaaaaaccaattcaaaa
aaagaaccaacgcaagaaaagaaaattgaagagaacacaaagagtacagataaaacgcct
gataagcctgcagcgaagagtggctttgctgggtttggagacaagagtgcaggggatggc
agtaactatgaccccagcaagcccaattatcatcccatcaatgatgccttctggaagaaa
ggagaaaaggttccatatttggcttgtgccaagacattccaagcaattgaaagtattaca
gccagattgaaaattgtcgagattcttgcaaacttcttccgttctgtcatagtcctgtct
cctgacgatcttcttccatgtttatatctgtgcctgaataagttagcccctgcttatgaa
ggggtggagttgggaattggagaaactgtcctcatgaaagctattgcccaagccacaggc
agaggtgtagacaaagttaaagctgatgcacaagaaaagggagacttgggaattgttgct
gaggcaagtcgcagtaaccagaggacaatgtttgcaccagcaaagttgatggcgtcaact
gtgtttactagactgaaagaaattgccaccatgtctggtaactcagtcatgtccaaaaag
atagacaaaatcaaggggatgtttgttgcctgccgtttctccgaggcccgttatttgatc
aggtcactcggaggcaaattacgaattggtttggcggagcagtctgtgctggtggcgctg
gctcatgctgtagtgctgacaccaccagggcaagaatatcccccagaaatcttagatgca
agtaatggcatttcagcagaaaaatttaagaaaaagatggatgatgctgcattgattatc
aaaacaacatactgtgaatgtccaacatatgataaaatcatcccagtactactgaaagaa
ggactggaagaactgcctaaacactgtaaacttacaccaggtatacctttaaaacctatg
ttggctcatccaactaagggagtgagtgaagtgttcagaaggtttgaagaagctgccttc
acttgtgaatataaatatgatggagaaagagctcagattcatgtccgagagggaggtgaa
ataaacatttacagcaggaattctgaggacaatacatccaagtatccagatataataggc
cgcatgaagtcctgtatgctgcccagtgtccagacatgtatactggacagtgaggcagtg
gcatgggaccaggagaaaaaaagtattttaccattccaagttctcagtaccagaaagaga
aaggatgcagatgcctcagaaatcaaagtccaagtgtgtgtctatgcatttgaccttctc
tacctcaatggagagtccttggtgaaggaaccatttagcagacggagagagctgttgcac
caatcattcaaagaagtcgaaggggaattcatgtttgccactcatttagattccaaagat
actgaccaaataggagaatttctggaagagtctataaaaggaaactgtgaaggacttatg
gtaaaaacactagatgtagatgctacttatgaaattgccaagcgttcccataattggctg
aagttaaagaaggattatttagagggagttggggacactctggatctggtagttatagga
ggctaccatggcactgggaaaagagcaggaaaatatggtggattcttgttggcttgctat
gatgaggaaaatgaagaatatcaaactatttgtaaaattggtactgggtttaaagatgat
gacctggaccaacacaatgcttctttaaagcagcatgtaatagacaagccccggtcatat
taccgctgtgacagtagccttgaccctgaccactggtttgatgctgtccaagtctgggag
gtcaaggccgctgacctgtccatctcacctgtccactctgctgctgcaggcttggttgac
ccagagaagggaatctctcttcgctttcctcgattcttgagaattcgggatgacaaaaag
ccagaggaggccacatctagtaaccaggtttctgaactgtatagaaaccagcagcaaata
aaaaatcagaacacagaaggaaaaacagaagaaggagaagaagatttttactaa

DBGET integrated database retrieval system