KEGG   Lingula anatina: 106178439
Entry
106178439         CDS       T04921                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
lak  Lingula anatina
Pathway
lak04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:lak00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106178439
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 106178439
NCBI-ProteinID: XP_013417061
UniProt: A0A1S3K478
LinkDB
Position
Unknown
AA seq 184 aa
MAVYCRRSFKMDITPSKSVRRRLDFGDERPDEAQVILELKDQARIIDEEKKRLWNFDFEL
EEPLEGNWLWERCCVPVESAQNDFVEKQESSHTDSENSDCIVGSTSSSVSSTALDLSVVQ
CVDNSFFSQVSERTPTISSSQKPSIRQQKITDMLKLKKRKLISSMKPQQSSRDNKKPKLE
KNAS
NT seq 555 nt   +upstreamnt  +downstreamnt
atggctgtgtattgcagacgatcattcaaaatggatataacaccaagtaaatctgttagg
cgacgactagattttggagatgaacgcccagacgaggctcaagtaattttggaactcaaa
gaccaagcgagaattatagacgaagagaagaaacggctgtggaattttgactttgaatta
gaagagccactggaaggaaactggctttgggaacgttgttgcgttcctgttgaaagtgcc
caaaatgacttcgttgaaaaacaggaatcctcacacacggatagtgaaaactcagactgt
atagtaggatctacgtcttcgtctgtatccagtacggcgttagacctatcagtagttcaa
tgtgtagataattcctttttcagccaagttagtgaaagaacgccaacaatttcttctagc
caaaaaccaagtatacgccaacagaaaattacagacatgctcaagctcaaaaaaagaaaa
ctgatttcatccatgaaaccccaacaaagctcaagagacaacaaaaagccaaaactagag
aaaaatgccagttag

DBGET integrated database retrieval system