KEGG   Lingula anatina: 106179427
Entry
106179427         CDS       T04921                                 

Definition
(RefSeq) uncharacterized protein LOC106179427 isoform X1
  KO
K21682  pyruvate dehydrogenase (NADP+) [EC:1.2.1.51]
Organism
lak  Lingula anatina
Brite
KEGG Orthology (KO) [BR:lak00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    106179427
Enzymes [BR:lak01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.51  pyruvate dehydrogenase (NADP+)
     106179427
SSDB
Motif
Pfam: POR_N FAD_binding_1 Flavodoxin_1 POR EKR NAD_binding_1 PFOR_II Fer4_7 TPP_enzyme_C Fer4_10 Fer4 Fer4_21 Fer4_9 Fer4_16 Fer4_6 Fer4_8 Fer4_17 Fer4_2 Fer4_4
Other DBs
NCBI-GeneID: 106179427
NCBI-ProteinID: XP_013418497
UniProt: A0A1S3K7M5
LinkDB
Position
Unknown
AA seq 1845 aa
MWKAVTSKAVQAPLRCRARAIDKVLLRQPHRTWRLATVEAVRPMASKPEKSSVRTMQTVS
PMPNLVENNTRDPVPKPKAEAAYAAMDGNEAAAYIAYALSDISFIYPISPATSMGDHMDK
WSAESKKNIFNSVVDVNMMQSEAGAAGSLHGAVAGGCLASTFTASQGLLLMVPNMYLLAG
ELMPCVFHVSARTVSKHALSIFNDHSDVMHCKSTGFAMLASSSVQEVMDMALVSHVASLK
SRIPFLHFFDGYRTSAEVSKIQPIPHADIAKIFPYEAQQKHLKEFALNPNEPKIRGTGQR
PDIFFQSTVAANKYYLACPGIVQETMDEVYALTGRKYDLFDYHGSPTADRVAVILGSASK
TLEETVDFMNRNGSNVGVVGVHLYRPFSDEHLLNAIPKTARKIAVLDRTREDGALAQPLF
MDVNVAFSNANRQALITGATYGLASKEFTPEMAVAVFDNLNAENPKMQYVIGIEDDVTHT
SLPYGEPITTVPPGTKQCMFWGLGSDGTVGANKEAIKTIGLNTNLKTQGHFVFDSHKADG
ITVSHVRFGPEEIKSEYIIQSDADYVSCHHPSYVEKFHQMLDPLSEGGTFVLNSPWTTME
QMEENLPAIFKQKLAKKKAKFYNISANKLAQSLGLGKRINMIMQTAFYELSGVLEVDEAI
ALLKKSIEKAYGHKGPKVVESNKSAVDAARQSLKRIDYPASWAQATEGGKRGEHTKATEF
VENIMNPVLALEGDKLPVSAFEPGGHMPIGTTQYEKRGIAPQIPVWKPDACTQCNYCAIV
CPHAVVRPFLLDKQETKNIPPGFEARRAKGGSEVSGYHYSIQISPMDCTGCEVCVESCPD
DALYMAPFDEVHEKYRPHWEYAVSLPEKGEIGDKFSVKGSQFQKPLMEFSGACAGCGETP
YVKLATQLFGDRMVIANSSGCSSVWGGTATTIPFTTNKDGRGPAWGRSLFEDTAEYGFGM
KLATKKRRRDLRNKMLVAMETCKISDELRGLFQKWIQNMDKNDQVEILAPMMEALLLKEM
ENQPDLVKVYNDRNLFRTQSHWLIGGDGWAYDIGYGGVDHVLSKGENINILVLDTEMYSN
TGGQVSKATQLSTVTKFAASGKRQNKKDLGMNAMLYENVYVASVAMGASYNQCVQAFKEA
ESFDGTSLIIAYSPCIDWGIEMKNMMHEQKEAVDSGYWPLYRYDPRRAEKGAIPFQLDSK
KIKGDFEKYLHGQNRFDQLFRKDKSLAEGLHGSFEHNTLHRHEKFQKMAMDEVEYLEYLK
ALHGEELSTEKSIVLYGSETGNAEALAGVFASELLRRGIRAKCLAMDDFEVDDLPKHSTV
YCVVATCGQGELPGNCRDFWEQLADKDLPSDYLENTRFAVFGLGDTSYVFYNEAAKKFNK
RLEELGGKRILNLGLGDDKDEEKYETAWNEWCPNLWNELGTPPPPQELLPPTYKVNIDTT
GEISAPTEALTPAGSKIIPLTKNVLLTPPDYDRDIRHYEFDLKGSGMTYSIGECLGIYPH
NNPEEVNQFLGDCGINPEHTVTLEDTSGRKEPLPPVISAGRLFGEVLDIFGRPSRRFYET
MSIAASDPSEKKELEYILSKDGADKMKELVKETVTYADLMKKYPSAKMPLDYMVDHVPRI
KPRLYSIASASEMHGDMLHLCIVKDDWNTPSGKYREGTCTRYLQHLSRGDKIDRVAGKIN
AAGINIPDNHRPPFVMVGLGTGLAPFRAFIEEREVSRQRGEDVGEMALFFGARYKRTDYT
YGDELEEYHSNGKGVLSVLSTAFSRDQAHKIYVQNRISEHPEVIYDYLVKKKGYFYLCGP
AGNVPPQVRKAVVEAFVKCGGHTPEEADKMVTDMQIEGRYNIEAW
NT seq 5538 nt   +upstreamnt  +downstreamnt
atgtggaaagcagtgacaagtaaagcggtccaggcaccactaaggtgccgcgcgagggcc
atcgataaagtccttttacgtcaaccacacagaacatggcgactggcaacagtagaagca
gttcgtcccatggcttcaaagcccgagaagagctccgtgcgcacaatgcaaactgtttca
cccatgccaaacttagtggagaacaatacccgtgatcctgtaccgaagcccaaggcagag
gcggcctatgctgccatggatggaaatgaagctgctgcttacattgcatatgccttgagt
gacatttcattcatttacccaatcagccctgccacctcaatgggggatcacatggacaag
tggtccgcggagtccaagaagaatatcttcaacagtgttgtcgatgtgaacatgatgcag
tcggaggctggtgcagcaggttctcttcatggggctgtggcaggtggttgtttggccagc
acatttacagcttcccaggggttgctgcttatggttcccaacatgtatctcctggctgga
gagctcatgccttgtgtgttccatgtttccgctaggacagtgtctaagcatgccctttcc
atcttcaacgatcactctgatgtcatgcattgcaaatcgacaggctttgccatgctggca
tcgagctctgtacaggaggtcatggacatggctttggtgtcccatgttgcctcattaaag
tcaaggataccttttctgcacttctttgatggatacagaacttcagcagaggtgtctaaa
attcagcctataccacatgctgacattgccaaaatatttccctatgaagcacagcagaaa
catctgaaagaatttgctctcaatccaaatgagcctaagatcaggggtacaggtcagaga
cctgatatctttttccagtccacggtggctgccaacaagtattatttagcttgcccaggt
attgtacaggaaaccatggatgaggtgtatgctctgactggacgcaagtatgacctgttt
gattaccatggatccccaactgcagaccgtgtggcagtaatattaggctcagcatcaaag
acactcgaagaaacagtagacttcatgaacagaaatggttccaatgttggtgtggtgggg
gtgcatctttatcgtcctttctcagatgaacacctgttgaatgctattcccaaaacagcc
agaaagattgctgtccttgacaggaccagggaagacggggctttagcccagccacttttc
atggatgtaaatgtagctttcagtaatgccaataggcaagcgttgatcactggcgccaca
tatgggctggcctcaaaggagttcacaccagaaatggctgtagctgtgtttgataacctt
aatgcagaaaaccccaagatgcagtatgtgataggtatagaagatgacgtgacgcacact
tccctgccctatggtgaacccattaccactgtgcccccgggaaccaagcagtgcatgttc
tggggtcttggatcggatggcacggttggagccaacaaagaagccatcaaaactattggc
ttaaacacaaatctgaagacccagggccactttgtgtttgactcccacaaagcagatggt
atcacagtatctcatgtgagatttggccctgaggaaatcaagtcagagtacatcattcag
tctgatgcagattatgtctcttgccatcacccttcctatgtcgagaagttccatcagatg
ttagatccactgagtgaaggtggcacttttgtgctgaattccccatggacaacaatggag
cagatggaagaaaacttaccagctatattcaaacagaagcttgcaaagaagaaggccaag
ttttacaacatttcagcaaacaaattggcacagagtcttggacttggaaaacgcatcaac
atgataatgcagacagcattctatgagctttctggagtccttgaagtggatgaggctatt
gctttattgaagaagtccattgagaaagcttatggccacaaaggtcctaaagtagtggaa
agcaataagagtgctgtggatgcagcaaggcagagcctgaagagaattgactatccagca
tcttgggcccaggccactgaaggcggcaagagaggagaacatacaaaggctacagagttt
gtggaaaacatcatgaacccagtgctggctctggaaggtgacaaactcccagtcagtgcc
tttgagccaggtggccatatgcccattggtacaactcagtatgagaagagaggtatagct
ccccagatcccagtgtggaagccagatgcctgcactcagtgcaactactgtgccatagta
tgcccacatgctgttgtgcgccctttcctgcttgacaagcaggagaccaagaatatccct
cccgggtttgaagccagacgtgccaaaggaggttctgaagtgtctggttaccattacagt
attcaaatctcccccatggattgcacaggctgtgaggtctgcgtggagtcctgtccagat
gatgctctctacatggcaccttttgatgaagtccatgagaagtaccgtccacactgggag
tatgctgtcagtcttcctgaaaagggagagattggagacaagttctcagtcaagggcagc
cagttccagaaaccacttatggagttctctggggcatgtgctggctgtggtgagactccc
tatgtgaagttggccacacagctatttggtgaccgtatggtgattgccaactcctctggc
tgttcatctgtgtggggaggcactgccaccaccattccattcaccaccaataaggatggt
cgtggtcctgcctggggaaggtctttatttgaggacacagcagagtatggctttggcatg
aaacttgccaccaagaaacgacgtcgtgatttgagaaacaaaatgctcgtagccatggaa
acatgtaagattagtgatgagctacgtgggttatttcaaaagtggatccaaaacatggat
aaaaatgaccaagtggagatccttgcacctatgatggaagctttgctgctgaaagagatg
gaaaaccagccagacctggtcaaggtgtataatgacagaaacctgtttagaacacagagt
cactggcttattggtggagatggatgggcttatgacatcggttatggtggagttgaccat
gtgctgtccaagggagagaacatcaacatccttgttcttgatacagagatgtactcgaac
acaggaggtcaggtctccaaagccacacagttgtccactgtcaccaaatttgctgcctct
ggtaagagacagaataagaaagatcttggaatgaatgcaatgctctatgaaaatgtctat
gtagcatcagttgctatgggggcaagctacaaccaatgtgtgcaagcctttaaagaagcg
gaatcctttgatggcacatcactcatcattgcctactctccatgtatcgactggggtatt
gagatgaagaatatgatgcatgaacagaaagaagcagttgattctggatactggccccta
taccgatatgatccacgccgcgctgaaaaaggagccatacctttccagttagactcaaag
aaaatcaagggagattttgagaagtacctacatgggcagaaccgttttgatcagttgttc
aggaaggataagtcccttgctgaaggtctgcatggttcctttgaacataacactttgcat
cgtcatgagaagttccagaagatggccatggatgaagtggaatatctggaatacttgaag
gccttgcatggggaggagttatctacagaaaaatccattgtcctgtacggctctgaaact
ggaaatgctgaggcattggcaggggtgtttgcctctgaacttttgagaagaggtatcaga
gcaaagtgtttggccatggatgactttgaggtggatgacctgccgaagcattcaactgtc
tattgtgtggtggcaacatgtggacagggagagttaccaggaaactgcagggacttctgg
gagcagcttgcagacaaggacctccctagcgactacctggagaacacaagatttgcagtg
tttggccttggtgatacttcttacgtgttctacaacgaagccgctaagaagtttaataaa
cgcctggaggagctgggtggaaagaggatcttgaatcttggcctgggagatgacaaggat
gaagagaaatatgagactgcgtggaatgaatggtgtcccaacctgtggaatgaactcggc
acaccaccaccaccacaagaactgctgccgcctacatataaagttaacatagataccact
ggagaaatttctgcccctacagaagccctcaccccagcaggctctaagataataccattg
accaaaaacgtcctcctgacacctccggactatgaccgcgacatccgtcattatgagttt
gacctgaaaggatcggggatgacatacagcattggtgaatgcctaggcatctatccacac
aataatccagaggaggtgaatcagtttttaggtgattgtggcatcaaccctgagcataca
gttacactggaggacactagtggccgcaaagaaccccttcctcctgtcatctcagctgga
cgcctctttggggaggtactggatatttttggcagacccagcagaaggttctatgagact
atgagcatagcagcatcagatccaagtgaaaagaaggaactagagtacatcttgagtaaa
gacggtgccgacaagatgaaagagcttgtgaaggagacagtgacctacgctgatctgatg
aagaagtatccatcagcaaaaatgccattggattacatggttgaccatgtcccccgcatt
aagccacgcctgtactccatagcctcggcctccgagatgcacggagacatgctgcacttg
tgtatagtgaaggacgactggaacaccccctctggaaagtacagagaaggcacgtgtacc
aggtacctacaacacttgagcagaggtgacaaaatagaccgtgtggctgggaaaatcaat
gcagctggtatcaatatcccagacaaccataggccgccatttgtaatggttggtcttggc
acaggcctcgcacctttccgtgctttcatcgaagagcgcgaggtgtcgagacagagaggt
gaagacgtaggcgagatggcattgttcttcggggcccgttacaaaagaacggattacacg
tatggagatgagctagaggagtaccactccaacgggaagggggttctcagtgtcttgtcc
acagccttttctagagaccaagctcacaagatttatgtgcagaaccgtatctctgaacac
cctgaggtcatctatgactacctggtgaagaagaagggctatttctacctgtgcggtcct
gcaggtaacgtccctccacaggtgcgcaaggcagttgtggaggcctttgtcaagtgtgga
ggccacacgccagaggaagctgataaaatggtgacagacatgcagattgaaggaagatac
aacattgaggcttggtaa

DBGET integrated database retrieval system