KEGG   Lingula anatina: 106181368Help
Entry
106181368         CDS       T04921                                 

Definition
(RefSeq) histone-lysine N-methyltransferase EZH2
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
lak  Lingula anatina
Pathway
lak00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:lak00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    106181368
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lak03036]
    106181368
Enzymes [BR:lak01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     106181368
Chromosome and associated proteins [BR:lak03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     106181368
   Polycomb group proteins
    PRC2-EZH2 complex
     106181368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET
Motif
Other DBs
NCBI-GeneID: 106181368
NCBI-ProteinID: XP_013421189
UniProt: A0A1S3KFF5
LinkDB All DBs
Position
Unknown
AA seq 852 aa AA seqDB search
MLHIHSLEYKLHYKDSRNCLFLGVSMTDTDAPGTVSTLQQHVNEWRKRVKSEYVRLRAQK
RLKRTDEIRSSFASNRRSINEAVEQQNEWWKRQSVQPLHAPETFSYMPVTKMCEVKSGMK
FPPQMAPLRMFNAIPTIPVMYTWAPLQQNYMVEDETVLHNIPYMGDDILEQDGAFIEDLI
KHYDGKVHSDREGNFIEDDVFVDLVKALTTLAPEVEREMGQPSSSSDDGPSELIFEAIAS
MFPDKGSAEELKEKFKELTEVKDQNILPPECTPSIDGPSAESVPREQTMHSFHTLFCRRC
FKYDCFLHPYHPTPSMLARKTPDVKTDSDPCGPDCFLHEENVNREIPDSIKGIKSSPRAK
KRKHGSHPSTVPSAIADDSEKSSDSSAFVPNSFKELTEVKDQNILPPECTPSIDGPSAES
VPREQTMHSFHTLFCRRCFKYDCFLHPYHPTPSMLARKTPDVKTDSDPCGPDCFLHEENV
NREIPDSIKGIKSSPRAKKRKHGSHPSTVPSAIADDSEKSSDSSDQSSSSKKSDTSCDWA
GAECSLFRCLHDVYYNNYCTMSKLIGTKTCKQVYEFAQKEAKHIPEVDADKDRTPPRKKK
KKQRLWSMHCRKIQLKKEGPSNHVYNYQPCDHPGIKCDETCPCVMAQNFCEKYCQCCPDC
TNRFPGCRCKAQCNTKQCPCFLAVRECDPDLCGMCGADQFDSKKFSCRNVSVQRGLRKHL
LLAPSDVAGWGIFLKEAAEKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNNDYV
VDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGICAKRPIQAGEELFFDYRYGPTEQL
KFVGIERETEVC
NT seq 2559 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacatacattcgttagaatacaaattacactacaaggattctagaaactgtcta
tttttgggtgtcagtatgactgatacagatgctccaggcacagtgtctacactgcagcaa
catgtcaacgaatggaggaagcgtgtcaagtctgagtatgtgaggctgagggcacaaaag
agactgaaacgtactgatgaaataaggagcagttttgccagcaatcgcaggagcatcaat
gaggcagtagagcaacaaaatgagtggtggaaacgacaaagtgtacagcccctgcatgca
ccagagacctttagctacatgccagtcaccaaaatgtgtgaggtgaagagtggtatgaag
tttcctccccagatggcgcccctcaggatgtttaatgccatacctactatccctgtgatg
tacacctgggcgccattgcagcagaactatatggtggaagacgaaactgtgttgcacaac
atcccctatatgggtgatgacattttggagcaggatggagctttcattgaggacctcatt
aaacactatgatggcaaagttcacagtgacagggaagggaatttcatcgaggatgatgta
tttgttgacttggtcaaagcactcactaccttggctcctgaagtggagagggagatgggt
cagcccagcagcagttctgacgatggtccaagtgagctgatatttgaagccattgccagc
atgtttccagacaaaggcagtgcagaggagctgaaagagaaatttaaagagttgactgaa
gtgaaggaccagaacattcttccgcccgagtgtacccccagtatagatggtcccagtgcg
gagagtgtgcccagagagcaaaccatgcactccttccacacactcttctgtaggaggtgt
tttaaatatgactgctttcttcacccataccaccccacacctagcatgttggcaaggaag
acaccagatgtgaaaacagattccgatccatgtggaccagattgctttctacacgaagag
aatgtaaatagagaaatcccagattcaatcaaaggcatcaaaagttctcccagggcgaag
aagcgtaaacatggcagccatccgtccacagtgcccagtgccattgcagatgacagtgaa
aagagttcagactcttcagcctttgtgcccaattcatttaaagagttgactgaagtgaag
gaccagaacattcttccgcccgagtgtacccccagtatagatggtcctagtgcggagagt
gtgcccagagagcaaaccatgcactccttccacacactcttctgtaggaggtgttttaaa
tatgactgctttcttcacccataccaccccacacctagcatgttggcaaggaagacacca
gatgtgaaaacagattccgatccatgtggaccagattgctttctacacgaagagaatgta
aatagagaaatcccagattcaatcaaaggcatcaaaagttctcccagggcgaagaagcgt
aaacatggcagccatccgtccacagtgcccagtgccattgcagatgacagtgaaaagagt
tcagactcttcagaccagtcatcgagctctaagaaatcagatacaagctgtgactgggca
ggagcagagtgttctctgttcaggtgtcttcatgatgtttactacaataattactgcacc
atgtccaaattgataggaacaaagacttgtaaacaggtgtatgagtttgcacagaaagaa
gccaaacacatccctgaggtagatgcagacaaagatcgaactccacctaggaaaaagaaa
aagaagcagaggctttggtctatgcattgccgtaagattcagttgaagaaagaaggtcca
tctaaccacgtgtacaactaccagccctgtgatcacccaggcatcaaatgtgatgaaacg
tgtccctgtgtgatggctcaaaacttttgtgagaaatactgccagtgctgcccagattgt
acaaaccgtttcccaggctgccgttgtaaagcccagtgcaataccaaacagtgtccctgc
tttctggctgtcagagaatgtgaccctgacctttgtggaatgtgtggtgctgatcaattt
gatagtaagaaattttcatgcagaaatgtcagcgtacagaggggactaagaaagcatcta
ctactagcaccatctgatgtggcggggtggggaatatttcttaaggaagcagcagagaaa
aatgaatttatatcagagtactgtggagagattatatctcaggatgaggctgatagaaga
ggaaaggtgtatgataaatatatgtgcagttttttgttcaatctaaacaatgattatgtg
gttgacgcaacacgcaaaggaaacaaaatccggtttgctaaccattctgtaaatcccaat
tgttatgccaaggtgatgatggtgaatggggaccaccgcattggtatatgtgctaagaga
ccaatccaggcaggagaggaactcttctttgactacagatatggtccaactgaacagctg
aaatttgtggggattgaacgcgaaacagaggtatgctaa

DBGET integrated database retrieval system