KEGG   Lacimicrobium alkaliphilum: AT746_00255Help
Entry
AT746_00255       CDS       T04189                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    AT746_00255
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lal02000]
    AT746_00255
Enzymes [BR:lal01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     AT746_00255
Transporters [BR:lal02000]
 Other Transporters
  Pores ion channels [TC:1]
   AT746_00255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_C GST_N_3 GST_C_3 GST_C_2 GST_N_2 GST_C_6 GST_N_4 GST_N_5
Motif
Other DBs
NCBI-ProteinID: ALS96859
UniProt: A0A0U2QIT5
LinkDB All DBs
Position
complement(49461..50057)
Genome map
AA seq 198 aa AA seqDB search
MKIYGDIRSGNCYKIKLLCALLGIGHQWIHVDILAGGTSSSDFLNKNPNGKIPLLELDDG
RCLSESNAILNYLAAGSDLLPEDPFELAKVQQWQFFEQYSHEPYIAVARFIARYLGLPEE
RRQEYESKQAGGHKALAVMEQQLTATPYLTGDKLTTADICLYGYTHVADEGGFDLSQYPA
VTAWLEKIASHPNYTGMA
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatatggcgatatccgctccggcaactgctataaaatcaaactgctgtgtgca
ttgctgggcattgggcaccagtggatccatgtggatatactggccggaggcacctcatcc
agtgattttctgaataaaaacccgaatggcaagattccgctgctggagctcgatgatggc
cgctgtttgtcagagtccaatgccatactcaattatctggctgctggcagcgacctgctg
ccggaagacccctttgagctggcaaaggttcagcagtggcaattcttcgagcaatacagc
cacgagccttatattgccgtggcacgttttatcgccagataccttggcctgcctgaggag
cgcaggcaggaatatgagtcgaaacaggccggcgggcataaagcgctggcggtgatggaa
caacaactgactgcgactccctatttaaccggtgataaattaaccacggccgatatctgt
ctgtatggatacacccacgttgcggatgaaggtggctttgacctaagtcagtatccggcc
gtaaccgcatggctggagaaaatagccagccacccgaattacaccggcatggcataa

DBGET integrated database retrieval system