KEGG   Lacimicrobium alkaliphilum: AT746_06060Help
Entry
AT746_06060       CDS       T04189                                 

Definition
(GenBank) hypothetical protein
  KO
K07090  uncharacterized protein
Organism
lal  Lacimicrobium alkaliphilum
Brite
KEGG Orthology (KO) [BR:lal00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    AT746_06060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: ALS97876
UniProt: A0A0U2Z5Y3
LinkDB All DBs
Position
complement(1336522..1337274)
Genome map
AA seq 250 aa AA seqDB search
MTLVLLAASSIGLSLGIFGSGGAVLALPVLVYLAGHEPKLAITGALFIVAAISTLSLLLS
HSKRLVDWQLALRLGITGMLGAYMGAWLGSLVSGLVQLTAFALLMLMASRFMYSGKVRLD
DKQTSLPLMLGVGTAVGMLTGFTGVGGGFLLVPAILRFTALDFFRARATSLVLINISAWT
GFAKNAWLLPDTSQLDWTLLLIIAAMGIVGSLLGQRWSVNWPQHRLRKGFALLLVILAAF
ILFQTLGDYL
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
gtgacactggtcttacttgcagcatccagtataggtcttagtcttggtatttttggctcc
ggcggcgccgtgctggcactgccggtactggtgtatctggcaggtcatgaacccaaactg
gcgattaccggcgcactgtttattgtggcggccatcagcaccctctcattactgctcagt
cacagcaaacgtctggttgactggcaactggctttacgccttggcatcaccggtatgctc
ggtgcctatatgggggcctggcttggcagcctggtttctggtctagtgcaattgacagca
tttgcgttactgatgctgatggcaagccgctttatgtacagtggtaaagtccgtctggat
gataaacaaaccagtctgcccttaatgctcggtgtaggcaccgcggtgggcatgctcacg
ggttttaccggcgttggcgggggatttttattggtgcccgctatactcaggtttaccgca
ctggatttttttcgcgccagagccaccagtttagtgctgatcaatatcagcgcctggact
ggctttgcaaaaaatgcctggctattaccagacaccagccaactggactggacattacta
ctgatcattgctgccatgggcatagtcggcagcctgctggggcagcgctggtcagttaac
tggcctcagcacaggttacgaaaaggctttgcactattgctggtgatattggccgcattt
attctgtttcagactttaggagattacttatga

DBGET integrated database retrieval system