KEGG   Lacimicrobium alkaliphilum: AT746_08585Help
Entry
AT746_08585       CDS       T04189                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00020  Citrate cycle (TCA cycle)
lal00190  Oxidative phosphorylation
lal00650  Butanoate metabolism
lal01100  Metabolic pathways
lal01110  Biosynthesis of secondary metabolites
lal01120  Microbial metabolism in diverse environments
lal01130  Biosynthesis of antibiotics
lal01200  Carbon metabolism
Module
lal_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lal_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lal_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT746_08585 (sdhB)
   00650 Butanoate metabolism
    AT746_08585 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT746_08585 (sdhB)
Enzymes [BR:lal01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     AT746_08585 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     AT746_08585 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ALS98301
UniProt: A0A0U2PFZ0
LinkDB All DBs
Position
1870129..1870839
Genome map
AA seq 236 aa AA seqDB search
MKLKFSIYRYNPDVDNAPRMQDYELDVEEGRDMMVLDALILLKEQDPTLAFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGKGKVVVRPLPGLPVVRDLVVDMSQFYTQYEKIKPYLI
NNDTKPPAREYLQSPEEREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
ADSRDTATEERLSELDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGQIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgaagttctcaatttatcgttacaatcctgatgtcgataatgcccctcgcatg
caggactatgagctggatgtagaagaaggccgtgacatgatggtgctggatgcactgatt
ttgctcaaagagcaggatccgacgctggcgtttcgccgctcatgccgtgaaggggtgtgt
ggctctgatggcgtgaatatgaacggcaaaaatggtctggcctgtatcacgccattgtct
gctttgggtaaagggaaagtcgttgtacgcccattgcccggactgccagtagtcagggat
ctggttgtagacatgagccagttctatactcagtacgagaaaattaagccttatctgatc
aacaatgacacgaagccgccggcgcgggagtacctgcaaagccctgaagagcgtgaaaag
cttgatggcttatatgagtgtattctttgtgcctgttgctctacatcctgtccgtcgttc
tggtggaatccggataagtttatcggcccggccgggttgctgcatgcttatcgttttctg
gctgacagccgtgacacggcaaccgaagagcgactcagcgagctggatgatgccttcagt
gtattccgttgccacggcattatgaattgtgtcagcgtttgtccaaaagggctgaatccg
accaaggcaattggtcagattaaatcaatgctattgcaacgcgctgtttag

DBGET integrated database retrieval system