KEGG   Lacimicrobium alkaliphilum: AT746_10610Help
Entry
AT746_10610       CDS       T04189                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lal  Lacimicrobium alkaliphilum
Brite
KEGG Orthology (KO) [BR:lal00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT746_10610
Enzymes [BR:lal01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AT746_10610
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 GIDA FAD_binding_2 DAO Glutaredoxin Thi4 FAD_oxidored FAD_binding_3 NAD_binding_9 NAD_binding_8 K_oxygenase DUF2190 AlaDh_PNT_C FMO-like Spermine_synth
Motif
Other DBs
NCBI-ProteinID: ALS98674
UniProt: A0A0U3AL26
LinkDB All DBs
Position
complement(2320885..2322462)
Genome map
AA seq 525 aa AA seqDB search
MLDNKVKSDLKTYLANLKRPVELTVAADQSKKSQELLSLATDISELSELVSIKQSNDSEL
RIPSMKVSSPDTGSNIIFSGLPMGHEFTSLVLALLHTGGHPIKQEAEILEQIKTLPGEYR
FETYVSLSCQTCPGVVQALNVMAAVNPNITNVMIDGSLFQDEVSERDVMAVPSVFLNGKP
FSQGAITLEKILNKVDDGAAEKQAEALNQKDDFDMLIIGAGPAGASSAIYSARKGIRTGL
VTDRFGGQVADTVGIENFISVKATEGPKLVASLEEHVRDYDVDIMNNQRVTSLREGNMLE
ITLENGAVLRSKSIVLATGARWREMNVPGEREYRGAGVAYCPHCDGPLYKGKKVAVIGGG
NSGIEAAIDLANIVEQVTVLEFDSKLRADDVLQRKARSMPNIEIITDAQTTEVNGDGKKV
TGLTYTDRKSGESKQVELAGIFVQIGLVPNTEWLKDSGVAMTSRGEIITKPNGETNIKGV
FAAGDATEVPFKQIIIAMGSGATAALGAFDYLMRSSAPEQESEAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttagacaacaaagtaaaaagcgatttaaaaacttatctggccaatctgaaacggccc
gttgaactgacggttgccgcagaccagagtaaaaagtctcaggaactactgagcctggcg
actgatatcagtgagctctctgaactggtcagtattaagcaaagcaatgatagtgagctg
cgtattcccagtatgaaggtaagcagccccgacacgggcagtaatattattttctccggc
ttgcccatgggtcacgaatttacctcactggtactggcgctgttgcacactggcggtcat
ccgattaagcaggaagccgaaatccttgagcagatcaaaactctgcccggtgaataccgt
tttgaaacctatgtgtcactcagttgccagacctgcccgggcgtggtgcaggcgctgaat
gtgatggcggcagtgaatcccaatatcaccaacgtgatgattgatggctcgttatttcag
gatgaagtcagcgagcgtgatgtgatggcggtgccctcggtattcttaaatggcaagcca
ttctctcagggtgctatcaccctggaaaagatcctgaataaagtggatgacggcgcggct
gaaaaacaggctgaggcgttaaatcaaaaagatgatttcgatatgctgatcatcggtgcc
ggtccggcaggggcgtcatcggccatatactcggcccgaaaaggcatccgcaccggcctg
gtaaccgaccgtttcggcggccaggtagctgacactgtagggattgaaaactttatctcg
gttaaagccacagaaggcccgaaactggtggccagtctcgaagagcatgtgcgtgactac
gatgtggatattatgaacaatcagcgggtaaccagcctgcgcgaaggcaatatgctcgag
attaccctggaaaacggtgcggtactgagatcaaaaagtatcgtgctggccaccggtgcc
cgctggcgcgaaatgaatgtgcccggtgaacgtgagtatcgtggagccggtgtggcctat
tgcccgcactgtgacgggcctttgtacaaaggtaagaaggttgcggtaataggtggcggg
aactctggtatcgaagcggctattgatctggctaatattgtcgaacaggttactgtgctg
gaatttgacagcaagctgcgagcagatgacgtactgcagcgcaaggcccgctcaatgcct
aatatcgaaattattaccgatgcccagaccactgaagttaatggcgatggcaaaaaggtt
actggtctcacttacaccgatcgtaaaagtggtgaatccaaacaggtggaactggccggg
atctttgtgcagatcggtctggtgcccaataccgaatggcttaaagacagcggtgtggcg
atgacctcccgtggcgagatcattaccaaacctaacggtgaaactaatatcaaaggggta
tttgctgcaggggatgccactgaagtgcccttcaagcagattattattgccatgggcagc
ggtgccactgccgcgctgggcgcctttgactacctgatgcgctcctcagcgccagagcag
gaaagcgaggccgcctga

DBGET integrated database retrieval system