KEGG   Lacimicrobium alkaliphilum: AT746_11065Help
Entry
AT746_11065       CDS       T04189                                 

Definition
(GenBank) anthranilate synthase subunit II
  KO
K01658  anthranilate synthase component II [EC:4.1.3.27]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lal01100  Metabolic pathways
lal01110  Biosynthesis of secondary metabolites
lal01130  Biosynthesis of antibiotics
lal01230  Biosynthesis of amino acids
lal02024  Quorum sensing
Module
lal_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AT746_11065
  09110 Biosynthesis of other secondary metabolites
   00405 Phenazine biosynthesis
    AT746_11065
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    AT746_11065
Enzymes [BR:lal01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     AT746_11065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase Peptidase_C26
Motif
Other DBs
NCBI-ProteinID: ALS98757
UniProt: A0A0U3BAT9
LinkDB All DBs
Position
2431157..2431759
Genome map
AA seq 200 aa AA seqDB search
MKQPNSKPHIFLIDNFDSFTYNLVDEMRCLGFELTVYRNSQCAEFILQKLNECPDPVLLM
LSPGPGAPADAGCVPALLKLVQGKFPVLGICLGHQAIVEHYGGTVGRAKQVMHGKASAIT
HQGRHMFANLPQPLPVARYHSLVATAVPSQLEVLAEFEDMAMALYHPQDKMLGFQFHPES
ILTALGSQLLAQSIHYLGDA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagccaaacagcaaaccccatatttttctgatcgataattttgattcattcacc
tacaacctggtggatgaaatgcgctgcttaggctttgaactgacggtgtatcgcaatagt
caatgtgctgagtttattctgcaaaaactgaatgaatgcccggacccggtactgctgatg
ctctcccccggtcccggcgcgccggccgatgcgggctgcgtaccggcgctgttaaaactg
gtgcagggcaaattcccggtgctggggatctgtctcggtcatcaggccattgtcgagcac
tacggcggcaccgtaggccgggctaaacaggtaatgcacggcaaggcctcggctatcacc
catcagggcagacatatgttcgccaatttaccccagcctctacccgtggcccgctatcat
tcactggttgccaccgccgtaccgtcgcagcttgaggtactggcagagttcgaagacatg
gctatggccctgtatcatccgcaagataagatgctgggttttcagtttcatcccgaatcc
attcttaccgctttgggcagccagttgctggctcagagtattcattatcttggagacgcc
tga

DBGET integrated database retrieval system