KEGG   Lacimicrobium alkaliphilum: AT746_11700Help
Entry
AT746_11700       CDS       T04189                                 

Definition
(GenBank) peptidyl-dipeptidase
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
lal  Lacimicrobium alkaliphilum
Brite
Enzymes [BR:lal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     AT746_11700
Peptidases [BR:lal01002]
 Metallo Peptidases
  Family M2
   AT746_11700
Exosome [BR:lal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT746_11700
CD molecules [BR:lal04090]
 Proteins
  AT746_11700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 ShlB tRNA_anti-like
Motif
Other DBs
NCBI-ProteinID: ALS98870
UniProt: A0A0U2JJ52
LinkDB All DBs
Position
2578764..2580596
Genome map
AA seq 610 aa AA seqDB search
MQRQKLTIPALVVAMALGTSACQQQPESQSPDTAKALTPEDARNFLKDAQAELEKLQLPA
VQAAWAYATYINQDTAAVSAYLSEKLSSRQAELAKEAAKFSDVQVDADARRQLNLLVNSF
VLAPPSDSEKSERLAKLSSELDGMYGKGKYCPEEGECMSLGDMTAKMARVRDHEQLLDIW
QGWRQISPPMKPLYEELVTLANEGAQELGFADTSELWRGKYDMPAEEFGPELDRTWNQVK
PFYDALHCHVRAKLGEHYGTDVVPQDLPIPAHLLGNMWAQTWGNIYELVKPEQKMKVPDV
TAALKDQDYDEIKMVKQAESFFSSLGFEELPETFWERSQFTKPRDREVICHASAWDIDDK
DDLRIKMCIQKTGEEFNVIHHELGHNYYQRAYKDQPLLYRGSANDGFHEAIGDTIALSIT
PKYLKQIDLIDEIPDESNDIGMLLQVALDKIAFIPFGLMVDQWRWKVFSGEVKPEDYNKV
WWELREKYQGVRAPIDRPADAFDPGAKYHVPGNTPYTRYFLAHILQFQFHKALCEIAGDE
GSIHRCSIYGSKEAGEALNAMLEMGMSRPWQEALESLTGSPQMDATAILDYFAPLKTWLD
EQNQGRQCGF
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgcaacgacaaaaacttaccataccagccctggttgtagcgatggcactgggaacatct
gcctgccaacagcaaccggagagtcaatcaccagacaccgccaaggcgctgacaccagaa
gacgcgcgcaattttctaaaagatgctcaggctgaactggaaaaactgcaactacccgct
gtccaggccgcctgggcttatgctacttacattaatcaggatactgccgctgtttcggct
tatttaagcgaaaagctctcttcgcggcaggcagaactggccaaagaagccgcgaaattc
agcgatgtacaggtagatgccgacgcccgccgccagttaaatctactggtgaattccttt
gtattggcaccgccatccgattctgagaagtcagagcgtctggccaaactgtcatccgaa
ctggatggtatgtacggcaagggtaaatattgccccgaagagggcgaatgtatgagcctg
ggcgatatgaccgcgaaaatggccagagtacgtgatcacgaacaactgctggatatctgg
cagggctggcggcaaatcagcccgcccatgaagcctttgtatgaagagctggtaaccctg
gctaatgagggcgcacaggagctgggcttcgctgacaccagtgaactgtggcgtggcaag
tatgacatgcccgccgaagagttcggccctgaactggaccggacctggaatcaggtaaaa
cctttttatgatgccctgcattgtcacgtgcgagccaaactgggtgaacattatggtaca
gatgtggtaccgcaggacctgcctattccggcgcacctgctgggcaatatgtgggcacag
acctggggcaatatttacgagctggtaaaacctgagcaaaagatgaaggtaccggatgtg
accgccgccctcaaagatcaggattatgacgaaataaaaatggtcaaacaggctgagtct
ttcttcagctcccttggctttgaagaactgccggaaaccttctgggaacgttctcaattt
accaagccccgtgacagagaggtcatctgccatgcttcggcctgggatattgatgataaa
gacgatctgcgcatcaaaatgtgtatccagaaaaccggggaagagtttaatgttatccac
catgagcttgggcataactattatcaacgtgcctataaagaccaacccttgttataccgt
ggctcagctaatgacggcttccatgaagccattggcgataccatcgccttgtcaatcacg
cctaaatacctgaagcagattgatctgattgatgaaatacctgatgagtccaatgatatt
ggcatgttgttgcaggtagcgctggataagattgctttcatcccattcggcttgatggta
gatcagtggcgctggaaagtattctccggtgaggtcaaacccgaagattacaataaggtc
tggtgggagctgcgcgagaaatatcagggtgtcagagcccctattgatcgccccgccgat
gcctttgaccctggtgccaagtatcatgtgccgggcaacacgccttatacacgctatttc
ctggcgcatattctgcagttccagttccataaggcgctgtgtgaaattgccggtgacgag
ggctccatccaccgctgctctatctatggcagcaaagaagccggtgaggccctgaatgcg
atgctggaaatgggcatgagccgcccctggcaggaagcgctggaaagcctgaccggttcg
ccgcaaatggacgccaccgcaatactggactacttcgccccgctgaaaacctggctggat
gaacaaaaccagggccgccagtgcggtttttaa

DBGET integrated database retrieval system