KEGG   Lacimicrobium alkaliphilum: AT746_13185Help
Entry
AT746_13185       CDS       T04189                                 

Definition
(GenBank) N-acetylmuramoyl-L-alanine amidase
  KO
K21469  serine-type D-Ala-D-Ala carboxypeptidase [EC:3.4.16.4]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AT746_13185
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:lal01002]
    AT746_13185
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lal01011]
    AT746_13185
Enzymes [BR:lal01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AT746_13185
Peptidases and inhibitors [BR:lal01002]
 Serine peptidases
  Family S12: D-Ala-D-Ala carboxypeptidase B family
   AT746_13185
Peptidoglycan biosynthesis and degradation proteins [BR:lal01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   AT746_13185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta-lactamase Amidase_2 PG_binding_1
Motif
Other DBs
NCBI-ProteinID: ALS99123
UniProt: A0A0U2Z875
LinkDB All DBs
Position
complement(2902435..2904912)
Genome map
AA seq 825 aa AA seqDB search
MKLEPVFFFLLRPFVLVNILLLTLLVGCTSLPIEQMPSKSYNHRVQFLVMHFTAIDYQRS
VNALVKGPYVSSHYLIPERFDDSYPDDELKVLQLVDEQHRAWHAGSSYWQGRNDLNDQSI
GIEIVNVPECEREMGHHFSDPFNGNEHGDGRLCIFPDYDPEQIALLVKLSKAILERHPDI
GPTQVVGHSDITPSRKNDPGPRFPWYQLYKEGIGAWYDNETVNHYWQQFTKAPPSLGLVQ
AALRTYGYGIEETGRMDAQTLDTLSAFQMHFLPWHVSGEASDKTAATLFALIDKYFPERL
TSLMERYNKEQIAEPEAEFAEPLGQVDSLFPEPEPSERKLVNDRKAFKAYAGEGEIIIDS
QDAEFAEIYVNGEQLNIQQPFAPDAQYRYSLARRTRDGTNHLRVENVQPEGASVRVRIPY
PVLQPSEGEKYDFSALDSLINSEIEQGYPGAVLLVVKDGQVIKHSAYGYKRLYDDNGGLL
PKPQAMSKDTLFDMASNTKMFATNFALMKLMTEGKLSFNDKVSRHIPEFKGQGRAAIRVK
DLLTHTAGYGPEVRFFERDNKFGEAFFSQNKARTVELLLHEVPLEIGRGIKPVYSDTGFL
LLGVLVERLTNMSLDQYVESQIYEPLGLHNTKFNPLRKGFVKSQFAATEIRGNSRGGRVS
FDNIRDYVLQGEVHDEKAYYAMQGVAGHAGLFSDASDMAVLTQVLLNRGGYGEQQVFAPS
VLDQFSKASDMDITLGLGWRRAGNGERRWHFGPYASPQAIGHTGWTGTVTVVDPEYDLAI
VLLTNRRHTPVVDLEEDLYGFKGDEFELGRYGSIISLIYEAVLSR
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagagcctgtgttttttttcctgttacgtccttttgttttagtaaatattctg
ttgctgacactactggttggctgcaccagtctgcctatcgagcagatgccttcaaaatcc
tacaaccacagagtgcagtttctggtgatgcattttaccgccattgactatcagagatcg
gtgaatgccctggtgaaagggccttatgtcagctcccattatctgattcctgagcgcttc
gatgacagttaccccgacgatgaactaaaagtattgcaactggtcgatgagcagcaccgg
gcctggcatgccggcagcagttactggcaggggcgtaatgacctcaacgatcagtcgatc
ggcatcgaaatcgtcaatgtgcctgagtgtgagcgcgagatgggtcaccatttcagcgat
ccctttaatggcaatgagcacggtgacggaaggctgtgtattttccctgactatgaccct
gagcaaatcgcattgttggtgaagctgtcaaaagcgattcttgagcgtcatcccgatatc
ggcccgacccaggtggtgggccactcggatattacccccagccgtaaaaacgatcctggc
cccagattcccctggtatcaactctataaagaggggattggtgcctggtatgacaatgaa
acagtcaaccattactggcagcaatttaccaaggccccaccttcattaggtttagtacag
gcagcactgagaacctacggatatggtattgaagaaacgggtcgtatggatgcacagaca
ctggatactctgtctgcctttcagatgcactttttgccctggcatgtcagtggtgaggcc
tcggataaaaccgcagctaccttgtttgccctgattgataagtatttccctgaacgactc
acgtcattaatggagcgctacaacaaagaacaaatagccgaaccggaggctgaatttgca
gaaccactggggcaggtggacagcctgttccctgagccggaacccagtgagcgcaagctg
gtgaatgatcgaaaggcgtttaaggcttatgcaggcgagggcgagatcatcatcgacagc
caggacgccgaatttgcagaaatttatgttaacggtgagcagcttaatatacagcagcct
tttgcgcctgatgcgcaataccgttattccctggcgcggcgcacccgggacggaactaat
catttgcgcgtcgaaaacgttcagcctgagggtgccagtgttcgtgtcaggatcccttac
ccggtactgcagccatctgagggtgaaaaatatgatttttctgcgctggatagtctgatt
aattcagagatcgaacagggctaccccggggctgtgttgctggtagtcaaagatgggcag
gtaatcaaacattctgcctacggctataagcggttatatgacgataacggcggattgctg
ccaaagccgcaggcgatgagcaaagacaccctgtttgatatggcctccaataccaaaatg
tttgccactaacttcgcgctgatgaagctgatgacagagggtaagctgagttttaacgac
aaggtatccaggcatatcccggaatttaagggccagggcagagctgcgatccgggttaag
gatttgctgacccatactgcaggttacgggccggaagtgcgctttttcgaaagggataac
aaatttggagaagccttcttctctcagaacaaagccagaacagtggaattattgcttcac
gaagtaccactggaaatcggccgtggcattaagcccgtttacagcgataccggcttttta
ctactgggagtgttagtagagcggctgaccaatatgagcctggatcagtatgtggaatcg
cagatttatgaaccactggggctgcataataccaagtttaatccgctcagaaagggcttt
gttaaaagtcagtttgcggctaccgagattcgtggcaacagccgcggcggtcgggtcagt
tttgacaacatccgagattatgtgttgcagggtgaagtgcatgatgaaaaggcctattac
gcaatgcaaggcgtagccggtcacgcaggattattctctgatgccagtgatatggccgtg
ctcactcaggtgctgctgaatcgcggtggctacggtgagcagcaggtttttgccccctct
gtgctggatcagttcagcaaagcctcggatatggatattacactgggacttggctggcgc
cgggcgggcaatggtgaacgccgctggcatttcggcccctatgccagccctcaggcgatc
ggccataccggctggacgggcacggtgacagtggtggacccggagtatgatctggccatt
gtgcttttgaccaatcgccgccatacgcctgtagtggaccttgaagaggacttgtatggt
tttaaaggcgatgaatttgagcttggccgttatggcagcattatttcgctgatttatgaa
gcggtactttctcgttga

DBGET integrated database retrieval system