KEGG   Lacimicrobium alkaliphilum: AT746_13620
Entry
AT746_13620       CDS       T04189                                 

Definition
(GenBank) alanine--tRNA ligase
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lal00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT746_13620
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:lal01007]
    AT746_13620
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:lal03016]
    AT746_13620
Enzymes [BR:lal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     AT746_13620
Amino acid related enzymes [BR:lal01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   AT746_13620
Transfer RNA biogenesis [BR:lal03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AT746_13620
 Prokaryotic type
    AT746_13620
SSDB
Motif
Pfam: tRNA-synt_2c DHHA1 tRNA_SAD DUF1465 HALZ CENP-F_leu_zip
Other DBs
NCBI-ProteinID: ALS99194
UniProt: A0A0U2RPA6
LinkDB
Position
complement(3003707..3006304)
AA seq 865 aa
MTISTADIRRKFFDYFSSHGHQLVPSSSLVPADDPTLLFTNAGMNQFKDVLLGAEKRSYN
RAVSAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKKEAIEFAWHFLTKELK
LPEQKLLVTIYAEDDEAFDIWSQHIGVPAEKIIRISTSDNFWSMGDTGPCGPCSEIFYDH
GEHIWGGPPGTPEEDGDRFIEIWNLVFMQYNRQADGTLEPLPKPSIDTGMGLERISAIMQ
DVHSNYEIDLFQALIKAAAEITGAKDLEDKSLRVVADHIRSCSFLIADGVLPSNEGRGYV
LRRIIRRAVRHGYKLGAQDIFFYRLVDALIGQMGEAYPELKTQRSTIERVLKVEEEQFSR
TLERGMQILQEALESLTDKTIPGELVFKLYDTYGFPADLTNDVAREKGFSIDEAGFEKAM
AEQRKRAQQASNFGVDYNSQLSSYSSSEFTGYDQQSGEARILELFSTDSKVQQLESGEQG
MVILDRTPFYAEAGGQVGDTGYLKLANGGFKITDTIKLGSAIAHKGIAEAPIKVGDKASL
QIDAERRQAIKLNHSATHLLHAALKNVLGEHVNQKGSLVDPERLRFDFSHFEGVSAGQIT
EIEDLVNQQIRLNHPLTTKLMDLEEAKSAGAQALFGEKYDDQVRVVSMGDFSMELCGGTH
VSQTGDIGLFRITSEGGIASGVRRIEAVTGAQALKFSQHQSQLLCDVAAQLKSDWHKLPE
RIGQLVEQSRNLEKEVQQLKQKMASQAGSDLLSDAYEINNVKVLSAKLEGVEPKSLRDLT
DTLKNKMGSGILVLAVAGDNKVSLIAGVTNDLTAKVKAGELVNFVAQQVGGKGGGRPDMA
QAGGSQPENLDQALASVSTWLQDKL
NT seq 2598 nt   +upstreamnt  +downstreamnt
atgactattagtactgctgacattcgacgcaaatttttcgattatttttccagccatggt
caccaactggtgcccagcagttcgctggtgcctgccgatgatccgaccctgctgtttacc
aatgccgggatgaaccagtttaaagatgtattgctgggtgcggaaaaacgcagttataac
cgggcggtttcggcacagcgctgtgtgcgtgccggcggtaagcataatgatctggagaat
gttggctatacggcccgtcatcacaccttttttgaaatgctgggcaatttcagctttggt
gactatttcaaaaaagaagccatagaatttgcctggcactttctgaccaaagaactgaag
ttgcctgagcaaaaactgctggtcaccatttatgccgaggacgatgaagcctttgatatc
tggtcacagcatattggtgtgccggcggagaaaattatccgtatcagtacctcagataat
ttctggtcgatgggcgataccgggccctgtggcccctgctcagaaatattctacgatcac
ggtgagcatatctggggcggcccgcccggcacgccggaagaagacggtgacaggtttatc
gagatctggaacctggtgtttatgcagtacaaccgccaggctgacggtaccctggaaccc
ctgcccaagccttctatcgatacggggatggggctggagcgtatctctgcgatcatgcag
gatgtgcacagcaattatgagattgatctgttccaggcgttgattaaagccgctgctgag
ataacaggtgctaaggatcttgaagataagtccctacgtgtagtggcggaccatatccgt
tcatgcagttttctgattgccgatggggtactgccctctaacgaaggtcgcggttatgtg
ctgcgacgtattatccgccgtgctgtacgtcatggttacaagctgggtgctcaggacatt
ttcttttacaggctggtggatgcgctgattggccagatgggtgaggcgtatcctgagctg
aaaacgcaacgcagtaccattgagcgggtactgaaagtggaagaagaacagttttccaga
acccttgagcggggcatgcagattttacaggaagcccttgaaagcctcaccgataagacc
attcccggtgagctggtatttaaactctatgatacctatggctttcctgcggatctgacc
aacgacgtggcccgtgaaaaaggctttagtatcgatgaagccgggtttgaaaaagccatg
gccgagcagcgtaaacgtgctcagcaggccagtaattttggcgtggattataacagccaa
ctgagcagctacagcagctcagagtttaccggttacgatcaacaaagcggtgaagcccgg
atactggagttgttcagcacagacagcaaagttcagcagctggaaagcggcgaacagggc
atggtgatactggaccgcacgcctttttatgctgaggctgggggtcaggtgggcgatacc
ggctatctgaaacttgccaatggcggctttaagataaccgacaccattaagcttggcagt
gccatagcccataaaggtattgctgaggcgccgattaaggtgggtgacaaggccagtctg
cagattgatgctgagcgtcgtcaggcgattaagctaaaccacagcgccactcacctttta
catgctgcgcttaaaaacgttttgggcgagcatgtgaatcagaaagggtctctggtggat
cctgagcgactgcgttttgatttttcgcattttgagggggtcagtgccgggcagatcacc
gaaatcgaagatctggtaaatcagcaaatccggctgaatcatccgctgaccactaagctg
atggacctcgaagaggccaaatctgccggagctcaggcactgtttggtgagaaatacgat
gatcaggtgcgggtggtgtccatgggcgatttttccatggagctgtgtggcggtacgcat
gtcagccagaccggcgacatcggtctgttccgtattaccagtgaaggcggcattgcatca
ggggtgcgtcgtatcgaagcagtaacaggggctcaggcgcttaaattttctcagcatcaa
agtcagttgctatgcgatgtggcggctcagctgaagagtgactggcataaattgcctgag
cgtatcggtcagttggttgagcaatccaggaaccttgaaaaagaggttcagcagcttaaa
cagaaaatggccagtcaggcgggatccgatttattatctgatgcgtatgaaataaacaat
gtcaaagtcctgtctgctaagttggaaggggtagagcccaagtctctgcgtgatttaacc
gataccctgaaaaacaagatgggctcaggcattctggttctggcggtagcgggcgacaac
aaggtcagcctgatcgccggggtaaccaatgatctgaccgcaaaggttaaggccggtgag
ctggtcaattttgtggctcaacaagttggcggaaaaggtggtggtcgtccggatatggct
caggcaggcggtagtcagcctgaaaatctcgaccaggcgctggcatctgtgtcgacatgg
ctgcaggataagctataa

DBGET integrated database retrieval system