KEGG   Lacimicrobium alkaliphilum: AT746_16220Help
Entry
AT746_16220       CDS       T04189                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lal  Lacimicrobium alkaliphilum
Pathway
lal00473  D-Alanine metabolism
lal00550  Peptidoglycan biosynthesis
lal01100  Metabolic pathways
lal01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lal00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AT746_16220
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AT746_16220
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AT746_16220
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lal01011]
    AT746_16220
Enzymes [BR:lal01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AT746_16220
Peptidoglycan biosynthesis and degradation proteins [BR:lal01011]
 Precursor biosynthesis
  Amino acid ligase
   AT746_16220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALS99655
UniProt: A0A0U2ZKX0
LinkDB All DBs
Position
complement(3594751..3595683)
Genome map
AA seq 310 aa AA seqDB search
MQVSEFGKVAVMFGGNSAERDVSLKSGTAVLQALLKAGVDAHAFDPAEQPLSVLLDEQFD
RVLIMLHGRGGEDGSMQGALQLLGLPYTGSGVLGSALAMDKIRSKQLWQSLDLPTSAFVV
AEKSTFEAAGCEDIIARLGGTVMVKPAREGSSIGMAKVTSADALRQAVTAAFEYDNEVLL
ERYIQGREFTVSLLQGQALPSIRMQTPRDFYDYEAKYQASSTEYFCPGGLSDELELRLAD
LAQQAFKAVGGSGWGRVDFMQDTEGNFYLLEANTVPGMTQKSLVPMAARQAGIDFGQLSL
SILQTSKECR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtctctgaattcggaaaagtggcggtgatgttcggtggtaactccgcagagcgg
gacgtgtctctgaaatcagggacggcggtattacaggcgctgttaaaggctggcgtcgat
gctcatgcttttgacccggcagagcagcccctttctgtgttgctcgacgagcagttcgac
agggtgcttatcatgctgcatggacggggtggtgaagatggcagcatgcagggcgcgctg
caattactgggtttgccttataccggctcaggggtgttgggttccgcattggcaatggat
aaaattcgcagcaaacagctatggcagagcctggatttgccaacatcggcctttgtggtg
gcagaaaaatccacctttgaagcggcaggttgtgaagatataattgcgcggttgggcgga
accgtcatggttaaacctgcccgagagggttccagcattggtatggccaaagtcacctct
gccgatgcactccgtcaggctgtgactgcggcctttgaatatgacaatgaagttttgctt
gagcgttatattcaggggcgtgagtttaccgtcagtctgcttcagggccaggcgctccct
tcgattcgaatgcaaactccccgggacttttacgattatgaagccaagtatcaggcatcc
agcaccgagtatttttgtcccggcggactgtctgacgagctggagctgagattggcagac
ctcgcccaacaggcgtttaaagctgtgggcggaagtggctggggcagagttgattttatg
caggatactgagggtaatttttatttgcttgaagccaatactgtgcccgggatgacacag
aagagtctggtacccatggcggcccggcaagccggaattgatttcgggcaattatcactg
tcgattttgcaaaccagtaaggagtgcagatga

DBGET integrated database retrieval system