KEGG   Lacimicrobium alkaliphilum: AT746_17510Help
Entry
AT746_17510       CDS       T04189                                 

Definition
(GenBank) MFS transporter
Organism
lal  Lacimicrobium alkaliphilum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-ProteinID: ALT00539
UniProt: A0A0U2RT03
LinkDB All DBs
Position
complement(3925182..3926591)
Genome map
AA seq 469 aa AA seqDB search
MESSATQDKDNQGFILFISIVATIGGFLFGFDSGVINGTVDGLQQAFNSQSVGTGFNVSS
MLLGCAVGAFFAGRLADIYGRRTLLRIAAICFVVSAWGSGIAGSSLEFVLYRVLGGLAVG
GASVMAPAYISEVAPARYRGMLTTIQQIAIISGLFLSFCSNYLLAEFAGASTAVLWMDFS
AWRWMFWMELIPATLFLLMLLFIPESPRFLVLKGHSEIAKQVLTRLYGSTAAQRKIDEIN
ASLADDHKPRFADLISRQTGKVRRIVWVGIGLATFQQLVGINVVFYYGAVLWQAVGFSES
DALLINVISGGLSIAACVITLMVIDKIGRKPLLKWGSVGMTLTLGLMVVAFSNADTDGAG
KLVMGEWGPLALISANAYVFFFNMSWGPVMWVMLGEMFPNQIRGSGLAVSGLAQWGSNFL
ITMTFPLLLTGIGLAGAYGLYTLGALISILFVVKMVHETKGTELEDMQG
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
attgaaagttcagcgactcaggataaagacaaccagggctttattctgtttatcagcatc
gttgccaccatcggcggttttctgtttggttttgacagtggcgtcatcaatggcacggtg
gatggtctgcaacaggcctttaactctcaaagtgtcggcactggatttaatgtttccagt
atgttgctcggttgtgcggtgggggctttcttcgctggtaggctggcagatatatatgga
cgtcggacgctgctgcgtatcgccgccatttgttttgtggtcagcgcctggggctcaggt
atagcaggaagttcactggaatttgtgttgtaccgggttctgggcggactggctgtgggc
ggtgcgtcggtgatggccccggcttatatttccgaagtggctccggcccgttaccggggg
atgctcaccactattcagcaaattgccattatcagcggcctgtttttgtctttttgcagt
aactatctgctggccgagtttgccggtgcctcgacggctgtgctgtggatggattttagc
gcctggcgctggatgttctggatggaactgatccccgcgacgttgtttttattgatgttg
ctgtttattcccgaaagcccccgttttctggtgctcaaaggtcacagtgaaatagcgaag
caggtactgacaaggctgtacggcagcacggccgcacagcgtaaaatcgatgaaattaac
gcgtcactggccgatgatcataagccccgttttgccgatttaatcagccgccagaccggc
aaagtgcgccgtatcgtctgggtgggcattggtctggccaccttccagcaactggtgggg
attaacgtggtattttattacggtgcggtgctgtggcaggcggtgggtttttccgaatcc
gatgccttgctgatcaatgtgattagcggtggcctgagtatcgccgcttgtgtgattacc
ctgatggtgatcgacaagattggccgtaaaccgctgctgaaatggggatcggtggggatg
acactgaccttaggcctgatggtggtggccttttccaacgctgatacggatggagcagga
aaactggtgatgggcgagtgggggccgctggcgctgatcagtgccaatgcctatgtgttt
ttctttaatatgtcctggggcccggtgatgtgggtgatgctgggtgaaatgttccccaat
cagattcgcggctcggggctggcggtcagtgggttagcccagtggggcagtaattttctg
attaccatgaccttccctctgctcctcactggtatcggtctggcaggggcctatggcctg
tataccctgggagcgctgatttctatcctgtttgtggtgaaaatggtgcatgaaaccaaa
ggcaccgaactggaagatatgcagggataa

DBGET integrated database retrieval system