KEGG   Lactobacillus allii: BTM29_06655Help
Entry
BTM29_06655       CDS       T05413                                 

Definition
(GenBank) phosphoribosyl-ATP diphosphatase
  KO
K01523  phosphoribosyl-ATP pyrophosphohydrolase [EC:3.6.1.31]
Organism
lalw  Lactobacillus allii
Pathway
lalw00340  Histidine metabolism
lalw01100  Metabolic pathways
lalw01110  Biosynthesis of secondary metabolites
lalw01230  Biosynthesis of amino acids
Module
lalw_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:lalw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    BTM29_06655
Enzymes [BR:lalw01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     BTM29_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PRA-PH
Motif
Other DBs
NCBI-ProteinID: APX72259
UniProt: A0A1P8Q359
LinkDB All DBs
Position
1364276..1364608
Genome map
AA seq 110 aa AA seqDB search
MQDLDELYALIKSRKENPKKGSYTDYLFTKGLDKILKKVGEESTEVVVAAKNPDKPRGDG
ELVYESADLLYHLCVLWVEQGVSFDQIKVELAKREGLMSDFKDRPEVKDL
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttagatgaattatatgctctgatcaagtcacgaaaagaaaatcctaaaaaa
ggttcatatactgattatttatttactaagggtctcgacaagattttgaaaaaggttggt
gaagaatcaactgaagtggtggtcgctgccaaaaatcctgacaagccacgtggagacggt
gagctggtttacgaatcagccgatttgttatatcacttatgtgtattgtgggtcgaacaa
ggagttagctttgatcaaatcaaagtagagttggctaagcgtgaaggcttaatgagtgat
ttcaaagatagaccggaagttaaagacttatag

DBGET integrated database retrieval system