KEGG   Lactobacillus allii: BTM29_08510Help
Entry
BTM29_08510       CDS       T05413                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lalw  Lactobacillus allii
Brite
KEGG Orthology (KO) [BR:lalw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lalw01001]
    BTM29_08510
Enzymes [BR:lalw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     BTM29_08510
Protein kinases [BR:lalw01001]
 Serine/threonine kinases: Other
  Bacterial family
   BTM29_08510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo APH DUF3244 Pox_ser-thr_kin ETRAMP Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: APX72588
UniProt: A0A1P8Q403
LinkDB All DBs
Position
1736385..1738349
Genome map
AA seq 654 aa AA seqDB search
MDKGYLVGGRYEILGTLGEGGMANVYLANDTKLNRKVAVKALRYDLQDDESVKRRFGREA
KATSGLSNPNIVNVLDVGTDNGIQYIVIEYVDGPNLKKYIKTHFPIAYHEVVDIMEQICL
AVADAHDHGIIHRDLKPENILVDTSKQPIQVKVSDFGIALALSDRSITRTNSLLGSVHYM
SPEQIRGKSATVLSDIYALGIILFELLTQHVPFTGDTAVSVALKHSKEDIPDLKTIDPNI
PQPLENAVLRATAKDPDQRYQSVREMCEDLDTCLLPERANEPKFIPIPLDDLGETKVIGE
APLVDDEDKEAPTKKRNKKKRKIILLSLIPIALVLLLIFMIVKGNEETSVPDLRNLTIKQ
ADVMLKGSNLNVGNISKENNDDVEAGHVIKSIPAKSLKLKNGAKVSLVVSLGATYYKMPN
VVGKDYDDVSDNLRKRGFKVKVKYKSSSKYESGVIISQSIKAGKKVVTKNKSLTLTLAKT
PTVKQKVVKVRDLSGYNLKSIQDYASEIGATLRVTYDYSDTIEDGVMISQSPEPDSVINK
GDTLSVVISKGKETETSDDDTDKSDSDNDSDSSASTATKTVSKDVTIPFDSSDSSNTITI
YLGDATHSINTVYKSMSISQDTAQTLVFNLKSGQNGSYNIERDGKTVLSGSVSG
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaggttacctagttggtggtcgatatgagattctaggtactcttggtgaaggt
ggcatggctaatgtttatttagctaatgacacaaaactgaatcgtaaagttgcagtaaaa
gctttaagatatgatcttcaagatgatgaatctgtcaaaaggagatttggacgtgaagcc
aaggctactagcggtctctctaatccgaatattgttaacgttttagacgttggcactgat
aatgggattcaatatattgtaattgagtatgttgatggccctaacttaaaaaaatatatt
aagacacattttccgattgcatatcatgaagtagtcgacataatggaacagatttgtttg
gctgtggctgatgcacatgaccatggaataattcaccgtgatttgaaaccagagaatatt
ttggttgatacttcaaaacagcctatacaagtcaaagtttctgactttggtattgcgttg
gcgttaagtgatagatcgattacgagaactaattctttattgggttctgttcactatatg
tcaccagaacaaattagaggtaaatctgccacagttttatctgatatttatgcacttgga
attatcttgtttgaattattgactcagcatgtaccctttaccggagatacggctgtgtca
gtcgctttaaagcattctaaagaagatataccagaccttaagacaattgacccaaatatt
ccacagcctcttgagaacgctgttttgagggccacagctaaggatccggatcagagatat
caatctgttcgtgaaatgtgcgaagacttggatacttgtttattgccagaacgtgctaat
gaaccaaagtttattcctataccactagatgatttaggagaaaccaaagttattggtgag
gctccactggttgatgatgaggataaggaagcaccaacgaaaaagagaaataagaaaaaa
agaaaaatcattttactatcattgattccaatagctttagttttgctattaatttttatg
attgttaagggtaacgaagaaacaagtgtgccagatcttcgaaatttaacgatcaaacaa
gcagacgtcatgttaaagggctcaaacctaaacgttggtaatatttctaaggaaaataat
gacgatgtagaagccggtcatgttattaaatcaattcctgctaaaagtttgaaactcaag
aatggtgctaaggttagcttggtcgttagtctgggtgctacttactacaagatgccaaat
gttgttggtaaggattatgatgatgtttctgacaatttaaggaagcgtggttttaaggta
aaagttaaatataaatcaagcagtaaatatgagtctggggtcattatttctcaaagtatt
aaagccggtaaaaaagtagtaaccaaaaataaatctttaacattaacactagcgaagaca
ccaacagtcaaacaaaaagtcgttaaggttagagatttatcaggatataatttaaagagt
atccaagattatgcaagtgagataggtgcaactttgcgtgttacatatgattattctgat
actattgaagatggagtaatgataagtcaaagtcctgaaccagacagcgtaatcaataag
ggggatactttgtcggttgttatttctaagggaaaagaaactgaaactagtgatgacgat
actgataaatcagatagcgataatgattcagattcttcggcatcaactgccactaagaca
gtgtctaaagacgttacaattccctttgattctagcgacagtagcaatacgataactatt
tatcttggagatgctacacacagtataaacaccgtttataagtcaatgagcatttcacaa
gacacagcacaaactttggtatttaatttaaagagtgggcaaaacggaagttataacatc
gaacgtgatggtaaaacagtattgtctggctcagtaagtgggtaa

DBGET integrated database retrieval system