KEGG   Lactobacillus amylolyticus: B1745_05420Help
Entry
B1745_05420       CDS       T05057                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
lamy  Lactobacillus amylolyticus
Pathway
lamy00970  Aminoacyl-tRNA biosynthesis
lamy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lamy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B1745_05420
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lamy03029]
    B1745_05420
Enzymes [BR:lamy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     B1745_05420
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     B1745_05420
Mitochondrial biogenesis [BR:lamy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    B1745_05420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-ProteinID: ARD07091
UniProt: A0A1V0JDY8
LinkDB All DBs
Position
complement(1073069..1073377)
Genome map
AA seq 102 aa AA seqDB search
MKITEDTVKHVATLSRLEFGDDEIGKFTEQMGSIINMASQLQEVDTEGVDETVQVVDRDT
VFREDKPEHWQGEDRETLMKNVPEKANGFIKVPVIIEKDDNE
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatcacagaagatacggttaaacacgttgctacactttcaagacttgaatttggc
gacgatgaaatcggtaaatttactgaacaaatgggttcgatcattaacatggccagtcaa
cttcaagaagttgatactgaaggtgttgatgaaactgttcaagttgttgatcgtgatact
gtctttagagaagacaaacctgaacattggcaaggtgaagatcgcgaaactttaatgaaa
aatgttcctgaaaaagctaatggcttcattaaggttcctgtaattattgagaaggacgat
aacgagtaa

DBGET integrated database retrieval system