KEGG   Lactobacillus amylolyticus: B1745_07280Help
Entry
B1745_07280       CDS       T05057                                 

Definition
(GenBank) aspartate kinase
  KO
K00928  aspartate kinase [EC:2.7.2.4]
Organism
lamy  Lactobacillus amylolyticus
Pathway
lamy00260  Glycine, serine and threonine metabolism
lamy00261  Monobactam biosynthesis
lamy00270  Cysteine and methionine metabolism
lamy00300  Lysine biosynthesis
lamy01100  Metabolic pathways
lamy01110  Biosynthesis of secondary metabolites
lamy01120  Microbial metabolism in diverse environments
lamy01130  Biosynthesis of antibiotics
lamy01210  2-Oxocarboxylic acid metabolism
lamy01230  Biosynthesis of amino acids
Module
lamy_M00525  Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lamy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    B1745_07280
   00270 Cysteine and methionine metabolism
    B1745_07280
   00300 Lysine biosynthesis
    B1745_07280
  09110 Biosynthesis of other secondary metabolites
   00261 Monobactam biosynthesis
    B1745_07280
Enzymes [BR:lamy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.4  aspartate kinase
     B1745_07280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase ACT_7 FTA4
Motif
Other DBs
NCBI-ProteinID: ARD07418
UniProt: A0A1V0JEY8
LinkDB All DBs
Position
pL6-1:complement(2491..3846)
Genome map
AA seq 451 aa AA seqDB search
MKVIKFGGSSLATGKQVERAIRIFLADDNRQAMVVSAPGKRFSDDIKVTDLLIKYAKTYL
NKQDTSEIVEQIFARYQEIGQYFGLTKEDLNFVKEILTSLPDQQYPNDDYLLAAFKAHGE
RLNAYLIAKILQHQGLNAKFLDPTEAGLIVTGEPNDASVSPETYLNLDQIRLQADEKIVF
PGFFGITPSGHIATFSRGGSDITGAILARGLHADLYENFTDVDGIFSANPAIIDDPESIH
QMTYREMRELSYAGFSVFHDEALIPAIQGDVPINVKNTNDPENPGTMILPEKDFHAEQTV
TGVASKKHFSALYLHKYLLNKEAGFTLRILQILDKHGIPYEHMPSGIDDITIIFDRKFLN
DQLIDLICSEIQATINPDQLEWIDDYAIIMIVGEGMKNQDGINARILNALLREHISPQMI
NQGASQISIMIGTKKEEADTAVKAIYNEFFK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaatcaagttcggtggtagttctttagctacaggcaagcaagttgaacgcgca
attaggatttttttggctgacgataatcgacaagcaatggttgtctcggctcctggcaaa
aggttcagcgatgacatcaaagttactgatttattgatcaaatatgcaaaaacatattta
aacaaacaagatactagcgaaattgttgagcaaatttttgcacgttaccaagaaataggc
caatattttggcttgactaaagaagatcttaactttgtcaaagaaatattaacgtccttg
cctgatcagcaatatcccaatgatgattatcttttggccgctttcaaagcacatggcgaa
cgcttaaacgcatacttgattgcaaaaattctgcagcatcaaggtctaaacgctaagttt
ttggatccgactgaggccggcttaatcgtaactggtgagcccaacgatgcttccgtcagc
cctgaaacctatttgaatttggatcagattcgccttcaagctgatgaaaaaatcgtcttt
cctggcttcttcggcatcacgccatctggccacatcgctactttttcacgaggcggttcg
gatatcactggtgcgattttagcgcgtggcctgcacgcagatctttacgaaaacttcact
gatgtagatggtatcttctcagctaacccagcaattattgatgatccggaatccattcac
cagatgacttaccgtgagatgcgggaattgtcctatgccggcttttccgttttccatgac
gaagcattgattccagctattcagggtgatgttccaattaatgtcaaaaacactaatgac
ccagagaatccgggcacgatgattttgccagaaaaagattttcacgctgaacaaacggta
actggcgttgccagcaagaagcatttctccgctttgtatttgcacaaatacttgcttaac
aaagaggctggttttaccttgcggatcttgcagattttggacaaacatggcattccatat
gagcacatgccttccggaattgacgatattactattatttttgaccggaaattcttgaat
gatcaattaatcgacctcatctgcagtgaaattcaagctacaatcaatccggatcagttg
gaatggatcgatgattatgccattattatgattgtgggcgaaggaatgaaaaatcaagat
ggcatcaacgccagaattttgaacgcattgcttcgtgaacatatttcaccacaaatgatc
aatcaaggtgcatcacaaatttcaattatgattggcaccaaaaaagaagaagcagatact
gcagttaaagcaatttacaacgaattttttaaatag

DBGET integrated database retrieval system