KEGG   Lactobacillus amylolyticus: B1745_07805Help
Entry
B1745_07805       CDS       T05057                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lamy  Lactobacillus amylolyticus
Pathway
lamy00061  Fatty acid biosynthesis
lamy00620  Pyruvate metabolism
lamy00640  Propanoate metabolism
lamy01100  Metabolic pathways
lamy01110  Biosynthesis of secondary metabolites
lamy01120  Microbial metabolism in diverse environments
lamy01130  Biosynthesis of antibiotics
lamy01200  Carbon metabolism
lamy01212  Fatty acid metabolism
Module
lamy_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lamy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    B1745_07805
   00640 Propanoate metabolism
    B1745_07805
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    B1745_07805
Enzymes [BR:lamy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     B1745_07805
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     B1745_07805
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C ATP-grasp Dala_Dala_lig_C RimK ATPgrasp_ST ATPgrasp_Ter ATPgrasp_YheCD ATP-grasp_5 DUF3182
Motif
Other DBs
NCBI-ProteinID: ARD07511
UniProt: A0A1V0JF58
LinkDB All DBs
Position
pL6-1:complement(99744..101129)
Genome map
AA seq 461 aa AA seqDB search
MFNKVLVANRGEIAVRIIRSLKEMGIKTVAIYSTADRDSLHVQLADEAECVGGPQPAESY
LNIKNILAAAVGTGAQAIHPGYGFLSESAEFAKMCSDCGLAFIGPKAETIDLMGNKEHAR
QMMIKNHVPVTPGSTGFINSAEEAKQIAAKIGYPVLLKAAAGGGGKGIRQVAKPEEMATA
LASAQSEAKTDFGDDRMYLEKVMQNVKHIEVQIFRDSFGNTVYFPERDCSLQRNKQKVLE
ESPCDLITDQERSKLGKIAVQAAEAADYVNTGTIEFLMDQDHNFYFMEMNTRIQVEHTIT
EMVTGVDLVKAQIKVAAGEKLPFSQTDLKAKGHAIECRINAENPANDFMPSVGRVDYLYL
PVGNPGMRIDSALYQGEVISPFYDSMIAKVLAFGKTRSEAIAKMRRLLKEMVIRGINTNQ
EFHLAILADPGFVKGEFTNTYLEQKFLPQWKEQLHGQAISA
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtttaataaggttttagttgctaatcgtggtgaaattgcggttagaatcattcgttct
ttaaaagaaatgggcattaagactgtagcgatttattcgacagctgaccgtgacagtttg
catgtgcagcttgctgatgaagcagaatgtgttggtggtccgcagcctgcagagtcatat
ttgaatattaaaaatattttggctgctgctgttggtactggtgcacaggctattcatccc
ggctatggctttctttcagaaagtgcagaatttgcgaaaatgtgcagcgattgtggtctt
gcttttatcggtcctaaggctgaaaccattgatctgatgggcaacaaggaacatgcacga
caaatgatgatcaagaatcatgttcctgtcacaccaggcagcaccggttttatcaattca
gctgaggaagcaaagcaaattgctgctaaaatcggctatcctgttttgcttaaggccgca
gctggtggtggcggaaaaggaattcgtcaagttgctaaacctgaagaaatggctacagct
ttagcctctgcccaaagtgaggctaagactgactttggcgacgatagaatgtatcttgaa
aaagttatgcaaaatgtaaagcatattgaggtgcagatttttagggactcattcggcaac
accgtttattttcctgaacgtgattgttcattgcaaagaaataagcaaaaagtgctggaa
gaaagtccatgtgatttaattaccgatcaagaacgaagcaagttaggaaagatcgccgtt
caagccgcagaagctgctgactatgtcaacacagggacgattgaattcttgatggatcaa
gatcataatttctactttatggaaatgaataccagaattcaggttgaacacactataact
gaaatggttactggtgttgatttggtcaaggcacaaatcaaggtagccgctggtgaaaag
ctgccattcagtcaaactgatttaaaggcaaagggacacgcaattgaatgccgaatcaac
gctgaaaatccagctaatgatttcatgccatcagtaggccgcgttgactatctttacttg
ccggttggcaacccagggatgagaattgattcagctttgtatcaaggtgaagtaatttca
ccattttatgactcaatgatcgcgaaagttcttgcttttggaaaaactcgcagcgaagca
atcgccaaaatgcgccgtttattaaaagaaatggtaattcgcggtatcaataccaaccaa
gaatttcacttagcaattcttgcagatcctggttttgtaaaaggtgaattcactaataca
tacttagagcaaaaattcttgccgcaatggaaggagcaattgcatggtcaagctatttca
gcataa

DBGET integrated database retrieval system