KEGG   Lacinutrix sp. 5H-3-7-4: Lacal_0909Help
Entry
Lacal_0909        CDS       T01533                                 

Definition
(GenBank) L-aminoadipate-semialdehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lan  Lacinutrix sp. 5H-3-7-4
Pathway
lan00010  Glycolysis / Gluconeogenesis
lan00053  Ascorbate and aldarate metabolism
lan00071  Fatty acid degradation
lan00280  Valine, leucine and isoleucine degradation
lan00310  Lysine degradation
lan00330  Arginine and proline metabolism
lan00340  Histidine metabolism
lan00380  Tryptophan metabolism
lan00410  beta-Alanine metabolism
lan00561  Glycerolipid metabolism
lan00620  Pyruvate metabolism
lan00625  Chloroalkane and chloroalkene degradation
lan01100  Metabolic pathways
lan01110  Biosynthesis of secondary metabolites
lan01120  Microbial metabolism in diverse environments
lan01130  Biosynthesis of antibiotics
Module
lan_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:lan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lacal_0909
   00053 Ascorbate and aldarate metabolism
    Lacal_0909
   00620 Pyruvate metabolism
    Lacal_0909
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Lacal_0909
   00561 Glycerolipid metabolism
    Lacal_0909
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Lacal_0909
   00310 Lysine degradation
    Lacal_0909
   00330 Arginine and proline metabolism
    Lacal_0909
   00340 Histidine metabolism
    Lacal_0909
   00380 Tryptophan metabolism
    Lacal_0909
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Lacal_0909
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Lacal_0909
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Lacal_0909
Enzymes [BR:lan01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Lacal_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AEH00757
UniProt: F6GFJ3
LinkDB All DBs
Position
complement(1050136..1051689)
Genome map
AA seq 517 aa AA seqDB search
MQAVSTDFGIKEALEQLGIKDVNHGTSTGSNNFGNGEEISSYSPTDGSLIAKVSTTTKED
YEKVMEAATSAFTTFRAMPAPQRGEIVRQFGNKLRELKEPLGKLVSYEMGKSLQEGYGEV
QEMIDICDFAVGLSRQLNGQTIPSERPGHVMREQWHSLGVVGIISAFNFPVAVWAWNTAL
AWVCGDVCVWKASEKTPLCSVACQNIIAGILKENNLPEGISCIINGDYKVGEMMTTDSRI
PLISATGSTRMGRIVGKTVAERFGKSLLELGGNNAIIITPTADLKVVVPGAVFGAVGTCG
QRCTSTRRLIIHESVYNKVRDAIVGAYGQLTIGNPLDEKNHIGPLIDKDSVDTYLAAIEK
AKAEGGTVLVEGGVLEGEGYESGCYVKPAIIEAENDFDIVQTETFAPILYLMKYSGDVEN
AIGTQNGVAQGLSSAIMTNEMKEAEKFLSFAGSDCGIANVNIGTSGAEIGGAFGGEKETG
GGRESGSDAWKVYMRRQTNTVNYSDELPLAQGIKFDL
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcagtttcaactgatttcggaataaaagaagccttagagcaattaggcataaaa
gatgtaaaccatggaacctctacaggttcaaataactttggaaatggagaggaaatttct
tcatattcaccaacagatggttctttaattgcaaaggtttctacaacaacaaaagaggat
tatgagaaagttatggaggcagctacttctgcttttacaacttttagagctatgccagca
ccgcaaagaggtgaaattgtaagacagtttggtaataaacttagagaattaaaagagcct
ttaggaaaattagtgtcttacgaaatgggtaaatcgcttcaagaaggttatggtgaagtg
caagaaatgattgacatttgtgattttgctgtaggtttatctagacaattaaacgggcaa
acaattccgtctgaacgtccaggtcacgtaatgcgtgagcaatggcattcattaggagtt
gtaggtataatttcagcttttaactttccagtagccgtttgggcttggaacacagcttta
gcttgggtttgtggagacgtttgtgtttggaaagcatcagaaaaaacaccactttgctca
gtagcttgccaaaatataattgcaggaattttaaaagaaaataatttgccagaaggtatt
tcttgtatcattaatggagactataaagtaggagaaatgatgactacagactctagaatt
ccattaatatctgctacaggttctactagaatgggacgtattgttggtaaaacagtggca
gaacgttttggaaaatctttattagaattaggtggaaataatgcaattattataacgcca
accgcagacttaaaagtagtagtcccaggagcagtatttggtgcggtaggaacttgtgga
caacgttgtacatctacaagacgattaattattcatgaaagtgtttacaataaagtacgt
gacgctattgttggtgcttatgggcagttaaccattggtaatcctttagatgaaaaaaat
cacataggtccattaatcgacaaggattctgtagacacttatttagcagcaattgaaaaa
gcaaaagctgaaggtggaactgttttggttgaaggtggtgttttagaaggtgaaggttac
gagtctggttgctatgtaaaaccagcgattattgaagcagaaaatgattttgatattgtg
cagacagaaacttttgctcctattttatatttaatgaaatactctggagatgttgaaaat
gcaattggtactcaaaatggagtagcgcaaggattatcttctgctattatgactaatgaa
atgaaagaagcagaaaaattcttatcgtttgcaggatcagattgtggaattgcaaatgta
aatattggaacatctggtgctgaaattggaggtgcttttggaggtgaaaaagaaacaggt
ggcggacgcgagtctggatctgatgcttggaaagtttacatgagacgccaaacaaataca
gtaaattattcagacgagttacctttagctcaaggtattaagtttgatttatag

DBGET integrated database retrieval system